eF-site ID 6ncm-B PDB Code 6ncm Chain B click to enlarge Title Crystal structure of the human FOXN3 DNA binding domain in complex with a forkhead-like (FHL) DNA sequence Classification DNA BINDING PROTEIN/DNA Compound Forkhead box protein N3 Source (6NCM) Sequence B:  NCKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYF ANAPTGWKNSVRHNLSLNKCFKKVDGSLWCIDPEYRQNLI QALKKTP Description Functional site 1) chain B residue 166 type sequence L description binding site for residue MG B 301 source : AC2 2) chain B residue 167 type sequence S description binding site for residue MG B 301 source : AC2 3) chain B residue 169 type sequence N description binding site for residue MG B 301 source : AC2 4) chain B residue 172 type sequence F description binding site for residue MG B 301 source : AC2 5) chain B residue 113-204 type DNA_BIND sequence CKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFA NAPTGWKNSVRHNLSLNKCFKKVDGSLWCIDPEYRQNLIQ ALK description Fork-head => ECO:0000255|PROSITE-ProRule:PRU00089 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links