eF-site ID 6ncm-ABCD PDB Code 6ncm Chain A, B, C, D click to enlarge Title Crystal structure of the human FOXN3 DNA binding domain in complex with a forkhead-like (FHL) DNA sequence Classification DNA BINDING PROTEIN/DNA Compound Forkhead box protein N3 Source (6NCM) Sequence A:  CKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFA NAPTGWKNSVRHNLSLNKCFKKVDKKGSLWCIDPEYRQNL IQALKKTPYHP B:  NCKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYF ANAPTGWKNSVRHNLSLNKCFKKVDGSLWCIDPEYRQNLI QALKKTP C:  ATAGCGTCTTAGCATG D:  TCATGCTAAGACGCTA Description Functional site 1) chain A residue 166 type sequence L description binding site for residue MG A 301 source : AC1 2) chain A residue 167 type sequence S description binding site for residue MG A 301 source : AC1 3) chain A residue 169 type sequence N description binding site for residue MG A 301 source : AC1 4) chain A residue 172 type sequence F description binding site for residue MG A 301 source : AC1 5) chain B residue 166 type sequence L description binding site for residue MG B 301 source : AC2 6) chain B residue 167 type sequence S description binding site for residue MG B 301 source : AC2 7) chain B residue 169 type sequence N description binding site for residue MG B 301 source : AC2 8) chain B residue 172 type sequence F description binding site for residue MG B 301 source : AC2 9) chain A residue 114-127 type prosite sequence KPPYSFSCLIFMAI description FORK_HEAD_1 Fork head domain signature 1. KPPYSFscLifm.AI source prosite : PS00657 10) chain A residue 158-164 type prosite sequence WKNSVRH description FORK_HEAD_2 Fork head domain signature 2. WKNSVRH source prosite : PS00658 11) chain A residue 113-204 type DNA_BIND sequence CKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFA NAPTGWKNSVRHNLSLNKCFKKVDKKGSLWCIDPEYRQNL IQALK description Fork-head => ECO:0000255|PROSITE-ProRule:PRU00089 source Swiss-Prot : SWS_FT_FI1 12) chain B residue 113-204 type DNA_BIND sequence CKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFA NAPTGWKNSVRHNLSLNKCFKKVDGSLWCIDPEYRQNLIQ ALK description Fork-head => ECO:0000255|PROSITE-ProRule:PRU00089 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links