eF-site ID 6n9d-B PDB Code 6n9d Chain B click to enlarge Title Complex of tissue inhibitor of metalloproteinases-1 (TIMP-1) mutant (L34G/L133P/L151C/G154A) with matrix metalloproteinase-3 catalytic domain (MMP-3cd) Classification HYDROLASE/HYDROLASE inhibitor Compound Stromelysin-1 Source (TIMP1_HUMAN) Sequence B:  CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTGYQRYEI KMTKMYKGFQALDIRFVYTPAMESVCGYFHRSHNRSEEFL IAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGC EECTVFPCPSIPCKLQSGTHCLWTDQCLQASEKGFQSRHL ACLPREPGLCTWQSL Description Functional site 1) chain B residue 1 type sequence C description binding site for residue ZN A 304 source : AC4 2) chain B residue 1 type BINDING sequence C description BINDING => ECO:0000269|PubMed:22427646 source Swiss-Prot : SWS_FT_FI1 3) chain B residue 34 type SITE sequence G description Involved in metalloproteinase-binding => ECO:0000269|PubMed:22427646, ECO:0007744|PDB:3V96 source Swiss-Prot : SWS_FT_FI2 4) chain B residue 135 type SITE sequence I description Involved in metalloproteinase-binding => ECO:0000269|PubMed:22427646, ECO:0007744|PDB:3V96 source Swiss-Prot : SWS_FT_FI2 5) chain B residue 155 type MOD_RES sequence S description Phosphoserine; by FAM20C => ECO:0000269|PubMed:26091039 source Swiss-Prot : SWS_FT_FI3 6) chain B residue 1-13 type prosite sequence CTCVPPHPQTAFC description TIMP Tissue inhibitors of metalloproteinases signature. CtCvPpHPQtaFC source prosite : PS00288 7) chain B residue 30 type CARBOHYD sequence N description N-linked (GlcNAc...) (complex) asparagine => ECO:0000269|PubMed:16263699, ECO:0000269|PubMed:16335952, ECO:0000269|PubMed:16740002, ECO:0000269|PubMed:19139490 source Swiss-Prot : SWS_FT_FI4 8) chain B residue 78 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000269|PubMed:16740002 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links