eF-site ID 6n9d-B
PDB Code 6n9d
Chain B

click to enlarge
Title Complex of tissue inhibitor of metalloproteinases-1 (TIMP-1) mutant (L34G/L133P/L151C/G154A) with matrix metalloproteinase-3 catalytic domain (MMP-3cd)
Classification HYDROLASE/HYDROLASE inhibitor
Compound Stromelysin-1
Source (TIMP1_HUMAN)
Sequence B:  CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTGYQRYEI
KMTKMYKGFQALDIRFVYTPAMESVCGYFHRSHNRSEEFL
IAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGC
EECTVFPCPSIPCKLQSGTHCLWTDQCLQASEKGFQSRHL
ACLPREPGLCTWQSL
Description (1)  Stromelysin-1 (E.C.3.4.24.17), Metalloproteinase inhibitor 1


Functional site

1) chain B
residue 1
type
ligand
sequence C
description binding site for residue ZN A 304
source : AC4


Display surface

Download
Links