eF-site ID 6n6j-B PDB Code 6n6j Chain B click to enlarge Title Human REXO2 bound to pAA Classification rna binding protein/rna Compound RNA exonuclease 2 homolog,Small fragment nuclease Source (6N6J) Sequence B:  AAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLN ILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKES TITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDK YMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAAS HRALDDISESIKELQFYRNNIFKKKI Description Functional site 1) chain B residue 97 type sequence R description binding site for residue MLI A 302 source : AC2 2) chain B residue 102 type sequence P description binding site for residue MLI A 302 source : AC2 3) chain B residue 151 type sequence E description binding site for residue MLI A 302 source : AC2 4) chain B residue 45 type sequence E description binding site for residue GOL B 301 source : AC4 5) chain B residue 169 type sequence S description binding site for residue GOL B 301 source : AC4 6) chain B residue 110 type sequence N description binding site for residue EDO C 701 source : AC5 7) chain B residue 167 type sequence D description binding site for residue EDO C 701 source : AC5 8) chain B residue 15 type sequence D description binding site for residue NA C 702 source : AC6 9) chain B residue 47 type BINDING sequence P description BINDING => ECO:0000269|PubMed:30926754, ECO:0000269|PubMed:31588022, ECO:0007744|PDB:6J7Y, ECO:0007744|PDB:6RCN source Swiss-Prot : SWS_FT_FI2 10) chain B residue 49 type BINDING sequence L description BINDING => ECO:0000269|PubMed:30926754, ECO:0000269|PubMed:31588022, ECO:0007744|PDB:6J7Y, ECO:0007744|PDB:6RCN source Swiss-Prot : SWS_FT_FI2 11) chain B residue 147 type BINDING sequence W description BINDING => ECO:0000269|PubMed:30926754, ECO:0000269|PubMed:31588022, ECO:0007744|PDB:6RCN source Swiss-Prot : SWS_FT_FI3 12) chain B residue 53 type SITE sequence Q description Important for dinucleotide binding => ECO:0000269|PubMed:30926754, ECO:0000269|PubMed:32365187 source Swiss-Prot : SWS_FT_FI5 13) chain B residue 96 type SITE sequence V description Important for dinucleotide binding => ECO:0000269|PubMed:30926754, ECO:0000269|PubMed:32365187 source Swiss-Prot : SWS_FT_FI5 14) chain B residue 164 type SITE sequence A description Important for dinucleotide binding => ECO:0000269|PubMed:30926754, ECO:0000269|PubMed:32365187 source Swiss-Prot : SWS_FT_FI5 15) chain B residue 92 type MOD_RES sequence F description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI6 16) chain B residue 122 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:15592455 source Swiss-Prot : SWS_FT_FI7 17) chain B residue 173 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9D8S4 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links