eF-site ID 6n3p-L PDB Code 6n3p Chain L click to enlarge Title Crosslinked AcpP=FabZ complex from E. coli Type II FAS Classification BIOSYNTHETIC PROTEIN Compound 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ Source (ACP_ECO45) Sequence L:  IEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVEL VMALEEEFDTEIPDEEAEKITTVQAAIDYI Description Functional site 1) chain L residue 36 type sequence S description binding site for Di-peptide XLN C 400 and HIS C 54 source : AC5 2) chain L residue 37 type sequence L description binding site for Di-peptide XLN C 400 and HIS C 54 source : AC5 3) chain L residue 36 type sequence S description binding site for Di-peptide XLN C 400 and HIS C 54 source : AC6 4) chain L residue 37 type sequence L description binding site for Di-peptide XLN C 400 and HIS C 54 source : AC6 5) chain L residue 35 type sequence D description binding site for Di-peptide XLN C 400 and SER L 36 source : AC7 6) chain L residue 37 type sequence L description binding site for Di-peptide XLN C 400 and SER L 36 source : AC7 7) chain L residue 38 type sequence D description binding site for Di-peptide XLN C 400 and SER L 36 source : AC7 8) chain L residue 39 type sequence T description binding site for Di-peptide XLN C 400 and SER L 36 source : AC7 9) chain L residue 40 type sequence V description binding site for Di-peptide XLN C 400 and SER L 36 source : AC7 10) chain L residue 66 type sequence Q description binding site for Di-peptide XLN C 400 and SER L 36 source : AC7 11) chain L residue 35 type sequence D description binding site for Di-peptide XLN C 400 and SER L 36 source : AC8 12) chain L residue 37 type sequence L description binding site for Di-peptide XLN C 400 and SER L 36 source : AC8 13) chain L residue 38 type sequence D description binding site for Di-peptide XLN C 400 and SER L 36 source : AC8 14) chain L residue 39 type sequence T description binding site for Di-peptide XLN C 400 and SER L 36 source : AC8 15) chain L residue 40 type sequence V description binding site for Di-peptide XLN C 400 and SER L 36 source : AC8 16) chain L residue 66 type sequence Q description binding site for Di-peptide XLN C 400 and SER L 36 source : AC8 17) chain L residue 36 type MOD_RES sequence S description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258, ECO:0000269|PubMed:4882207 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links