eF-site ID 6n3p-L
PDB Code 6n3p
Chain L

click to enlarge
Title Crosslinked AcpP=FabZ complex from E. coli Type II FAS
Classification BIOSYNTHETIC PROTEIN
Compound 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
Source (ACP_ECO45)
Sequence L:  IEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVEL
VMALEEEFDTEIPDEEAEKITTVQAAIDYI
Description (1)  3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (E.C.4.2.1.59), Acyl carrier protein


Functional site

1) chain L
residue 36
type
ligand
sequence S
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC5

2) chain L
residue 37
type
ligand
sequence L
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC5

3) chain L
residue 36
type
ligand
sequence S
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC6

4) chain L
residue 37
type
ligand
sequence L
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC6

5) chain L
residue 35
type
ligand
sequence D
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

6) chain L
residue 37
type
ligand
sequence L
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

7) chain L
residue 38
type
ligand
sequence D
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

8) chain L
residue 39
type
ligand
sequence T
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

9) chain L
residue 40
type
ligand
sequence V
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

10) chain L
residue 66
type
ligand
sequence Q
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

11) chain L
residue 35
type
ligand
sequence D
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

12) chain L
residue 37
type
ligand
sequence L
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

13) chain L
residue 38
type
ligand
sequence D
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

14) chain L
residue 39
type
ligand
sequence T
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

15) chain L
residue 40
type
ligand
sequence V
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

16) chain L
residue 66
type
ligand
sequence Q
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

17) chain L
residue 31-46
type prosite
ligand
sequence DLGADSLDTVELVMAL
description Phosphopantetheine attachment site.[DEQGSTALMKRH]-[LIVMFYSTAC]-[GNQ]-[LIVMFYAG]-[DNEKHS]-S-[LIVMST]-{PCFY}-[STAGCPQLIVMF]-[LIVMATN]-[DENQGTAKRHLM]-[LIVMWSTA]-[LIVGSTACR]-{LPIY}-{VY}-[LIVMFA].
source prosite : PS00012


Display surface

Download
Links