eF-site ID 6n3p-K
PDB Code 6n3p
Chain K

click to enlarge
Title Crosslinked AcpP=FabZ complex from E. coli Type II FAS
Classification BIOSYNTHETIC PROTEIN
Compound 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
Source (ACP_ECO45)
Sequence K:  ASTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDT
VELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQ
Description (1)  3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (E.C.4.2.1.59), Acyl carrier protein


Functional site

1) chain K
residue 35
type
ligand
sequence D
description binding site for Di-peptide XLN B 400 and SER K 36
source : AC3

2) chain K
residue 37
type
ligand
sequence L
description binding site for Di-peptide XLN B 400 and SER K 36
source : AC3

3) chain K
residue 38
type
ligand
sequence D
description binding site for Di-peptide XLN B 400 and SER K 36
source : AC3

4) chain K
residue 35
type
ligand
sequence D
description binding site for Di-peptide XLN B 400 and SER K 36
source : AC4

5) chain K
residue 37
type
ligand
sequence L
description binding site for Di-peptide XLN B 400 and SER K 36
source : AC4

6) chain K
residue 38
type
ligand
sequence D
description binding site for Di-peptide XLN B 400 and SER K 36
source : AC4

7) chain K
residue 0
type
ligand
sequence A
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

8) chain K
residue 0
type
ligand
sequence A
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

9) chain K
residue 0
type
ligand
sequence A
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

10) chain K
residue 0
type
ligand
sequence A
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

11) chain K
residue 36-37
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence SL
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_B_400


Display surface

Download
Links