eF-site ID 6n3p-K PDB Code 6n3p Chain K click to enlarge Title Crosslinked AcpP=FabZ complex from E. coli Type II FAS Classification BIOSYNTHETIC PROTEIN Compound 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ Source (ACP_ECO45) Sequence K:  ASTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDT VELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQ Description Functional site 1) chain K residue 35 type sequence D description binding site for Di-peptide XLN B 400 and SER K 36 source : AC3 2) chain K residue 37 type sequence L description binding site for Di-peptide XLN B 400 and SER K 36 source : AC3 3) chain K residue 38 type sequence D description binding site for Di-peptide XLN B 400 and SER K 36 source : AC3 4) chain K residue 35 type sequence D description binding site for Di-peptide XLN B 400 and SER K 36 source : AC4 5) chain K residue 37 type sequence L description binding site for Di-peptide XLN B 400 and SER K 36 source : AC4 6) chain K residue 38 type sequence D description binding site for Di-peptide XLN B 400 and SER K 36 source : AC4 7) chain K residue 0 type sequence A description binding site for Di-peptide XLN E 400 and SER G 36 source : AD4 8) chain K residue 0 type sequence A description binding site for Di-peptide XLN E 400 and SER G 36 source : AD5 9) chain K residue 0 type sequence A description binding site for Di-peptide XLN E 400 and HIS E 54 source : AD6 10) chain K residue 0 type sequence A description binding site for Di-peptide XLN E 400 and HIS E 54 source : AD7 11) chain K residue 36 type MOD_RES sequence S description O-(pantetheine 4'-phosphoryl)serine => ECO:0000255|PROSITE-ProRule:PRU00258, ECO:0000269|PubMed:4882207 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links