eF-site ID 6n3p-F
PDB Code 6n3p
Chain F

click to enlarge
Title Crosslinked AcpP=FabZ complex from E. coli Type II FAS
Classification BIOSYNTHETIC PROTEIN
Compound 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
Source (ACP_ECO45)
Sequence F:  THTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNV
SVNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGK
LEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGL
TRFKGVALVDGKVVCEATMMCARSRE
Description (1)  3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (E.C.4.2.1.59), Acyl carrier protein


Functional site

1) chain F
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

2) chain F
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

3) chain F
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

4) chain F
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

5) chain F
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

6) chain F
residue 122
type
ligand
sequence R
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

7) chain F
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

8) chain F
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

9) chain F
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

10) chain F
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

11) chain F
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

12) chain F
residue 122
type
ligand
sequence R
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

13) chain F
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

14) chain F
residue 23
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

15) chain F
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

16) chain F
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

17) chain F
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

18) chain F
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

19) chain F
residue 122
type
ligand
sequence R
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

20) chain F
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

21) chain F
residue 23
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

22) chain F
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

23) chain F
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

24) chain F
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

25) chain F
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

26) chain F
residue 122
type
ligand
sequence R
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

27) chain F
residue 33
type
ligand
sequence E
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

28) chain F
residue 34
type
ligand
sequence E
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

29) chain F
residue 35
type
ligand
sequence G
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

30) chain F
residue 37
type
ligand
sequence F
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

31) chain F
residue 54
type
ligand
sequence H
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

32) chain F
residue 55
type
ligand
sequence F
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

33) chain F
residue 60
type
ligand
sequence I
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

34) chain F
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

35) chain F
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

36) chain F
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

37) chain F
residue 116
type
ligand
sequence T
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

38) chain F
residue 117
type
ligand
sequence F
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

39) chain F
residue 50
type
ligand
sequence F
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

40) chain F
residue 53
type
ligand
sequence G
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

41) chain F
residue 55
type
ligand
sequence F
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

42) chain F
residue 56
type
ligand
sequence P
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

43) chain F
residue 60
type
ligand
sequence I
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

44) chain F
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

45) chain F
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

46) chain F
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

47) chain F
residue 54-55
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence HF
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

48) chain F
residue 60-64
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence IFPGV
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

49) chain F
residue 101-104
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence FKRP
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

50) chain F
residue 19
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence H
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_E_400

51) chain F
residue 68
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence E
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_E_400

52) chain F
residue 90-94
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence LYYFA
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_E_400

53) chain F
residue 122
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence R
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_E_400

54) chain F
residue 124
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence L
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_E_400


Display surface

Download
Links