eF-site ID 6n3p-E
PDB Code 6n3p
Chain E

click to enlarge
Title Crosslinked AcpP=FabZ complex from E. coli Type II FAS
Classification BIOSYNTHETIC PROTEIN
Compound 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
Source (ACP_ECO45)
Sequence E:  THTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNV
SVNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGK
LEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGL
TRFKGVALVDGKVVCEATMMCARSRE
Description (1)  3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (E.C.4.2.1.59), Acyl carrier protein


Functional site

1) chain E
residue 33
type
ligand
sequence E
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

2) chain E
residue 34
type
ligand
sequence E
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

3) chain E
residue 35
type
ligand
sequence G
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

4) chain E
residue 37
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

5) chain E
residue 54
type
ligand
sequence H
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

6) chain E
residue 62
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

7) chain E
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

8) chain E
residue 101
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

9) chain E
residue 102
type
ligand
sequence K
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

10) chain E
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

11) chain E
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

12) chain E
residue 116
type
ligand
sequence T
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

13) chain E
residue 117
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD4

14) chain E
residue 33
type
ligand
sequence E
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

15) chain E
residue 34
type
ligand
sequence E
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

16) chain E
residue 35
type
ligand
sequence G
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

17) chain E
residue 37
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

18) chain E
residue 54
type
ligand
sequence H
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

19) chain E
residue 62
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

20) chain E
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

21) chain E
residue 101
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

22) chain E
residue 102
type
ligand
sequence K
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

23) chain E
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

24) chain E
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

25) chain E
residue 116
type
ligand
sequence T
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

26) chain E
residue 117
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and SER G 36
source : AD5

27) chain E
residue 50
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

28) chain E
residue 53
type
ligand
sequence G
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

29) chain E
residue 55
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

30) chain E
residue 56
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

31) chain E
residue 60
type
ligand
sequence I
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

32) chain E
residue 62
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

33) chain E
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

34) chain E
residue 101
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

35) chain E
residue 102
type
ligand
sequence K
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

36) chain E
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

37) chain E
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD6

38) chain E
residue 50
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

39) chain E
residue 53
type
ligand
sequence G
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

40) chain E
residue 55
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

41) chain E
residue 56
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

42) chain E
residue 60
type
ligand
sequence I
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

43) chain E
residue 62
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

44) chain E
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

45) chain E
residue 101
type
ligand
sequence F
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

46) chain E
residue 102
type
ligand
sequence K
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

47) chain E
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

48) chain E
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN E 400 and HIS E 54
source : AD7

49) chain E
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

50) chain E
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

51) chain E
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

52) chain E
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

53) chain E
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

54) chain E
residue 148
type
ligand
sequence S
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

55) chain E
residue 150
type
ligand
sequence E
description binding site for Di-peptide XLN F 400 and SER J 36
source : AD8

56) chain E
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

57) chain E
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

58) chain E
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

59) chain E
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

60) chain E
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

61) chain E
residue 148
type
ligand
sequence S
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

62) chain E
residue 150
type
ligand
sequence E
description binding site for Di-peptide XLN F 400 and HIS F 54
source : AD9

63) chain E
residue 19
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence H
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

64) chain E
residue 68
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence E
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

65) chain E
residue 71
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence A
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

66) chain E
residue 90-93
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence LYYF
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

67) chain E
residue 146
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence A
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

68) chain E
residue 148
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence S
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

69) chain E
residue 150
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence E
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_F_400

70) chain E
residue 54-55
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence HF
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_E_400

71) chain E
residue 60-64
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence IFPGV
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_E_400

72) chain E
residue 101-104
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence FKRP
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_E_400


Display surface

Download
Links