eF-site ID 6n3p-D
PDB Code 6n3p
Chain D

click to enlarge
Title Crosslinked AcpP=FabZ complex from E. coli Type II FAS
Classification BIOSYNTHETIC PROTEIN
Compound 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
Source (ACP_ECO45)
Sequence D:  NTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKN
VSVNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVG
KLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRG
LTRFKGVALVDGKVVCEATMMCARSR
Description (1)  3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (E.C.4.2.1.59), Acyl carrier protein


Functional site

1) chain D
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC5

2) chain D
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC5

3) chain D
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC5

4) chain D
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC5

5) chain D
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC5

6) chain D
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC6

7) chain D
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC6

8) chain D
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC6

9) chain D
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC6

10) chain D
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN C 400 and HIS C 54
source : AC6

11) chain D
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

12) chain D
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

13) chain D
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

14) chain D
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

15) chain D
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC7

16) chain D
residue 19
type
ligand
sequence H
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

17) chain D
residue 68
type
ligand
sequence E
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

18) chain D
residue 91
type
ligand
sequence Y
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

19) chain D
residue 92
type
ligand
sequence Y
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

20) chain D
residue 93
type
ligand
sequence F
description binding site for Di-peptide XLN C 400 and SER L 36
source : AC8

21) chain D
residue 33
type
ligand
sequence E
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

22) chain D
residue 34
type
ligand
sequence E
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

23) chain D
residue 35
type
ligand
sequence G
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

24) chain D
residue 37
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

25) chain D
residue 54
type
ligand
sequence H
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

26) chain D
residue 55
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

27) chain D
residue 61
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

28) chain D
residue 62
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

29) chain D
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

30) chain D
residue 101
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

31) chain D
residue 102
type
ligand
sequence K
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

32) chain D
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

33) chain D
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

34) chain D
residue 116
type
ligand
sequence T
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

35) chain D
residue 117
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AC9

36) chain D
residue 33
type
ligand
sequence E
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

37) chain D
residue 34
type
ligand
sequence E
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

38) chain D
residue 35
type
ligand
sequence G
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

39) chain D
residue 37
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

40) chain D
residue 54
type
ligand
sequence H
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

41) chain D
residue 55
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

42) chain D
residue 61
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

43) chain D
residue 62
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

44) chain D
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

45) chain D
residue 101
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

46) chain D
residue 102
type
ligand
sequence K
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

47) chain D
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

48) chain D
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

49) chain D
residue 116
type
ligand
sequence T
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

50) chain D
residue 117
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and SER H 36
source : AD1

51) chain D
residue 50
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

52) chain D
residue 53
type
ligand
sequence G
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

53) chain D
residue 55
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

54) chain D
residue 56
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

55) chain D
residue 60
type
ligand
sequence I
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

56) chain D
residue 61
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

57) chain D
residue 62
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

58) chain D
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

59) chain D
residue 101
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

60) chain D
residue 102
type
ligand
sequence K
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

61) chain D
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

62) chain D
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD2

63) chain D
residue 50
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

64) chain D
residue 53
type
ligand
sequence G
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

65) chain D
residue 55
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

66) chain D
residue 56
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

67) chain D
residue 60
type
ligand
sequence I
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

68) chain D
residue 61
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

69) chain D
residue 62
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

70) chain D
residue 63
type
ligand
sequence G
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

71) chain D
residue 101
type
ligand
sequence F
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

72) chain D
residue 102
type
ligand
sequence K
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

73) chain D
residue 103
type
ligand
sequence R
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

74) chain D
residue 104
type
ligand
sequence P
description binding site for Di-peptide XLN D 400 and HIS D 54
source : AD3

75) chain D
residue 54-55
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence HF
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_D_400

76) chain D
residue 60-63
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence IFPG
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_D_400

77) chain D
residue 101-104
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence FKRP
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_D_400

78) chain D
residue 19
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence H
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_C_400

79) chain D
residue 68
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence E
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_C_400

80) chain D
residue 71
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence A
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_C_400

81) chain D
residue 90-94
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence LYYFA
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_C_400

82) chain D
residue 148
type binding
ligand XLN: N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide
sequence S
description N~3~-{(2R)-4-[(dihydroxyphosphanyl)oxy]-2-hydroxy-3,3-dimethylbutanoyl}-N-(3-{[(1Z)-pent-1-en-1-yl]sulfonyl}propyl)-beta-alaninamide binding site
source pdb_hetatom : XLN_6n3p_C_400


Display surface

Download
Links