eF-site ID 6n1k-A PDB Code 6n1k Chain A click to enlarge Title Full-length human phenylalanine hydroxylase (PAH) in the resting state Classification OXIDOREDUCTASE Compound Phenylalanine-4-hydroxylase Source (PH4H_HUMAN) Sequence A:  ETSYIEDNQNGAISLIFSLKEEVGALAKVLRLFEENDVNL THIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDI GATVHELSRDKKKDTVPWFPRTIQELDRFANQILLDADHP GFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTW GTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQL EDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQ YIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIG LASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGL LSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYY VAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT QQLKILADSINSEIGILCS Description Functional site 1) chain A residue 297 type sequence R description binding site for residue CL A 501 source : AC1 2) chain A residue 285 type sequence H description binding site for residue FE A 502 source : AC2 3) chain A residue 290 type sequence H description binding site for residue FE A 502 source : AC2 4) chain A residue 330 type sequence E description binding site for residue FE A 502 source : AC2 5) chain A residue 71 type sequence R description binding site for residue CL B 501 source : AC3 6) chain A residue 281-292 type prosite sequence PDICHELLGHVP description BH4_AAA_HYDROXYL_1 Biopterin-dependent aromatic amino acid hydroxylases signature. PDicHELLGHVP source prosite : PS00367 7) chain A residue 285 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P04176 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 290 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P04176 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 330 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P04176 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links