eF-site ID 6mwq-A PDB Code 6mwq Chain A click to enlarge Title Single particle cryoEM structure of a DARPin-aldolase platform in complex with GFP Classification LYASE/FLUORESCENT PROTEIN Compound DARPin, Muscle-type aldolase chimeric fusion Source (GFP_AEQVI) Sequence A:  SGSDLGKKLLEAARAGQDDEVRILMANGADVNALDRFGLT PLHLAAQRGHLEIVEVLLKCGADVNAADLWGQTPLHLAAT AGHLEIVEVLLKYGADVNALDLIGKTPLHLTAIDGHLEIV EVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN LSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEEN RRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFP QVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERC AQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYA SICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYK ALSDHHIYLEGTLLKPNMVTPGHACTQKYSHEEIAMATVT ALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKP WALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALAN SLACQGKYTPSGQ Description Functional site 1) chain A residue 202 type catalytic sequence D description 222 source MCSA : MCSA1 2) chain A residue 315 type catalytic sequence K description 222 source MCSA : MCSA1 3) chain A residue 356 type catalytic sequence E description 222 source MCSA : MCSA1 4) chain A residue 358 type catalytic sequence E description 222 source MCSA : MCSA1 5) chain A residue 398 type catalytic sequence K description 222 source MCSA : MCSA1 6) chain A residue 469 type catalytic sequence S description 222 source MCSA : MCSA1 7) chain A residue 267 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI8 8) chain A residue 315 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI8 9) chain A residue 300 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P05065 source Swiss-Prot : SWS_FT_FI11 10) chain A residue 480 type MOD_RES sequence K description N6-malonyllysine => ECO:0000250 source Swiss-Prot : SWS_FT_FI12 11) chain A residue 279 type MOD_RES sequence K description N6-malonyllysine; alternate => ECO:0000250 source Swiss-Prot : SWS_FT_FI10 12) chain A residue 204 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI6 13) chain A residue 207 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI6 14) chain A residue 214 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI6 15) chain A residue 440 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI6 16) chain A residue 210 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI7 17) chain A residue 276 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI9 18) chain A residue 498 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI9 19) chain A residue 211 type BINDING sequence R description BINDING => ECO:0000269|PubMed:10504235, ECO:0007744|PDB:6ALD source Swiss-Prot : SWS_FT_FI3 20) chain A residue 440 type BINDING sequence S description BINDING => ECO:0000269|PubMed:10504235, ECO:0007744|PDB:6ALD source Swiss-Prot : SWS_FT_FI3 21) chain A residue 472 type BINDING sequence R description BINDING => ECO:0000269|PubMed:10504235, ECO:0007744|PDB:6ALD source Swiss-Prot : SWS_FT_FI3 22) chain A residue 241 type SITE sequence C description Essential for substrate cleavage source Swiss-Prot : SWS_FT_FI4 23) chain A residue 276 type SITE sequence K description Essential for substrate cleavage source Swiss-Prot : SWS_FT_FI4 24) chain A residue 315 type SITE sequence K description Alkylation inactivates the enzyme source Swiss-Prot : SWS_FT_FI5 25) chain A residue 390-400 type prosite sequence IYLEGTLLKPN description ALDOLASE_CLASS_I Fructose-bisphosphate aldolase class-I active site. IyLEGtLLKPN source prosite : PS00158 26) chain A residue 210 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0000250|UniProtKB:P04075 source Swiss-Prot : SWS_FT_FI13

Display surface Download Links