eF-site ID 6msh-F PDB Code 6msh Chain F click to enlarge Title Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome Classification HYDROLASE Compound 26S proteasome non-ATPase regulatory subunit 1 Source (PSB4_HUMAN) Sequence F:  EQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTH ELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVKCAVI KTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETL PTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVL PMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQT KATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIF IDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNT QVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARAR IMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAG MIALRRGATELTHEDYMEGILEVQAKKKANLQYYA Description (1)  26S proteasome Functional site 1) chain F residue 344 type sequence R description binding site for residue ATP E 401 source : AC4 2) chain F residue 187 type sequence D description binding site for residue ADP F 501 source : AC5 3) chain F residue 188 type sequence I description binding site for residue ADP F 501 source : AC5 4) chain F residue 229 type sequence P description binding site for residue ADP F 501 source : AC5 5) chain F residue 230 type sequence G description binding site for residue ADP F 501 source : AC5 6) chain F residue 231 type sequence T description binding site for residue ADP F 501 source : AC5 7) chain F residue 232 type sequence G description binding site for residue ADP F 501 source : AC5 8) chain F residue 233 type sequence K description binding site for residue ADP F 501 source : AC5 9) chain F residue 234 type sequence T description binding site for residue ADP F 501 source : AC5 10) chain F residue 365 type sequence I description binding site for residue ADP F 501 source : AC5 11) chain F residue 393 type sequence G description binding site for residue ADP F 501 source : AC5 12) chain F residue 394 type sequence A description binding site for residue ADP F 501 source : AC5 13) chain F residue 326-344 type prosite sequence VKVIAATNRVDILDPALLR description AAA AAA-protein family signature. VkVImATNradtLDpALl.R source prosite : PS00674

Display surface Download Links