eF-site ID 6msb-u
PDB Code 6msb
Chain u

click to enlarge
Title Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome
Classification HYDROLASE
Compound 26S proteasome non-ATPase regulatory subunit 1
Source (PSB4_HUMAN)
Sequence u:  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQRESTLHLVLRLRGG
Description (1)  26S proteasome


Functional site

1) chain u
residue 27-52
type prosite
ligand
sequence KAKIQDKEGIPPDQQRLIFAGKQLED
description Ubiquitin domain signature.K-x(2)-[LIVM]-x-[DESAK]-x(3)-[LIVM]-[PAQ]-x(3)-Q-x-[LIVM]-[LIVMC]-[LIVMFY]-x-G-x(4)-[DE].
source prosite : PS00299


Display surface

Download
Links