eF-site ID 6mr0-A PDB Code 6mr0 Chain A click to enlarge Title Crystal Structure of the All-trans Retinal Bound R111K:Y134F:T54V:R132Q:P39Q:R59Y:L121E Human Cellular Retinoic Acid Binding Protein II Mutant After 5 Minutes UV irradiation at 2.6 Angstrom Resolution Classification LIPID BINDING PROTEIN Compound Cellular retinoic acid-binding protein 2 Source (RABP2_HUMAN) Sequence A:  PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKQA VEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELI ETMTADDVVCTQVFVRE Description Functional site 1) chain A residue 15 type sequence F description binding site for residue RET A 201 source : AC1 2) chain A residue 27 type sequence M description binding site for residue RET A 201 source : AC1 3) chain A residue 32 type sequence A description binding site for residue RET A 201 source : AC1 4) chain A residue 39 type sequence Q description binding site for residue RET A 201 source : AC1 5) chain A residue 63 type sequence I description binding site for residue RET A 201 source : AC1 6) chain A residue 76 type sequence V description binding site for residue RET A 201 source : AC1 7) chain A residue 109 type sequence W description binding site for residue RET A 201 source : AC1 8) chain A residue 111 type sequence K description binding site for residue RET A 201 source : AC1 9) chain A residue 121 type sequence E description binding site for residue RET A 201 source : AC1 10) chain A residue 5-22 type prosite sequence GNWKIIRSENFEELLKVL description FABP Cytosolic fatty-acid binding proteins signature. GNWkIirSeNFEeLLKVL source prosite : PS00214 11) chain A residue 132 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:16979656, ECO:0007744|PDB:2FR3 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 101 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:21998312 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links