eF-site ID 6mqd-A PDB Code 6mqd Chain A click to enlarge Title Myotoxin II from Bothrops moojeni complexed with Rosmarinic Acid Classification TOXIN Compound Basic phospholipase A2 homolog 2 Source ORGANISM_COMMON: Lance-headed viper; ORGANISM_SCIENTIFIC: Bothrops moojeni; Sequence A:  SLFELGKMILQETGKNPAKSYGVYGCNCGVGGRGKPKDAT DRCCYVHKCCYKKLTGCDPKKDRYSYSWKDKTIVCGENNS CLKELCECDKAVAICLRENLDTYNKKYRYNYLKPFCKKAD PC Description Functional site 1) chain A residue 125 type sequence P description binding site for residue ROA A 201 source : AC1 2) chain A residue 126 type sequence F description binding site for residue ROA A 201 source : AC1 3) chain A residue 127 type sequence C description binding site for residue ROA A 201 source : AC1 4) chain A residue 44-51 type prosite sequence CCYVHKCC description PA2_HIS Phospholipase A2 histidine active site. CCYvHKcC source prosite : PS00118 5) chain A residue 95-105 type prosite sequence LCECDKAVAIC description PA2_ASP Phospholipase A2 aspartic acid active site. LCECDKAVaIC source prosite : PS00119 6) chain A residue 16 type SITE sequence K description Cationic membrane-docking site (MDoS) => ECO:0000305|PubMed:29287778 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 20 type SITE sequence K description Cationic membrane-docking site (MDoS) => ECO:0000305|PubMed:29287778 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 115 type SITE sequence K description Important residue of the cationic membrane-docking site (MDoS) => ECO:0000250|UniProtKB:I6L8L6, ECO:0000305|PubMed:29287778 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 118 type SITE sequence R description Important residue of the cationic membrane-docking site (MDoS) => ECO:0000250|UniProtKB:I6L8L6, ECO:0000305|PubMed:29287778 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 122 type SITE sequence L description Hydrophobic membrane-disruption site (MDiS) => ECO:0000250|UniProtKB:I6L8L6 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 126 type SITE sequence F description Hydrophobic membrane-disruption site (MDiS) => ECO:0000250|UniProtKB:I6L8L6 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 123 type SITE sequence K description Cationic membrane-docking site (MDoS) => ECO:0000250|UniProtKB:I6L8L6 source Swiss-Prot : SWS_FT_FI4 13) chain A residue 129 type SITE sequence K description Cationic membrane-docking site (MDoS) => ECO:0000250|UniProtKB:I6L8L6 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links