eF-site ID 6mo1-B PDB Code 6mo1 Chain B click to enlarge Title Structure of dengue virus protease with an allosteric Inhibitor that blocks replication Classification VIRAL PROTEIN/INHIBITOR Compound FLAVIVIRUS_NS2B/Peptidase S7 Source (Q91H74_9FLAV) Sequence B:  MADLELERAADVRWEEQAEISGSSLEDGAYRIKQKGILGY SQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVK KDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKP GLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGIA NTEK Description Functional site 1) chain B residue 1054 type sequence R description binding site for residue I16 B 1201 source : AC2 2) chain B residue 1073 type sequence K description binding site for residue I16 B 1201 source : AC2 3) chain B residue 1074 type sequence K description binding site for residue I16 B 1201 source : AC2 4) chain B residue 1075 type sequence D description binding site for residue I16 B 1201 source : AC2 5) chain B residue 1149 type sequence L description binding site for residue I16 B 1201 source : AC2 6) chain B residue 1151 type sequence G description binding site for residue I16 B 1201 source : AC2 7) chain B residue 1165 type sequence I description binding site for residue I16 B 1201 source : AC2

Display surface Download Links