eF-site ID 6me3-A PDB Code 6me3 Chain A click to enlarge Title XFEL crystal structure of human melatonin receptor MT1 in complex with 2-phenylmelatonin Classification MEMBRANE PROTEIN Compound chimera protein of Melatonin receptor type 1A and GlgA glycogen synthase Source (MTR1A_HUMAN) Sequence A:  PSWLASALACVLIFTIVVDILGNLLVILSVYRNKKLRNAG NIFVVSLAVANLVVAIYPYPLVLMSIFNNGWNFGYLHCQV SAFLMGLSVIGSIWNITGIAIDRYLYICHSLKYDKLYSSK NSLCYVLLIWLLTLAAVLPNLRAGTLQYDPRIYSCTFAQS VSSAYTIAVVVFHFLVPMIIVIFCYLRIWILVLQVRGIDX SFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRG QKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWAR SLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPF GLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPG ELANAILKALELSRSDLSKFRENCKKRAMSFSKLKPQDFR NFVTMFVVFVLFAICFAPLNFIGLAVASDPASMVPRIPEW LFVASYYMAYFNSCLNPIIYGLLDQNFRKEYRRIIVSLCT ARV Description Functional site 1) chain A residue 104 type sequence A description binding site for residue JEY A 1201 source : AC1 2) chain A residue 107 type sequence M description binding site for residue JEY A 1201 source : AC1 3) chain A residue 108 type sequence G description binding site for residue JEY A 1201 source : AC1 4) chain A residue 111 type sequence V description binding site for residue JEY A 1201 source : AC1 5) chain A residue 162 type sequence N description binding site for residue JEY A 1201 source : AC1 6) chain A residue 178 type sequence T description binding site for residue JEY A 1201 source : AC1 7) chain A residue 179 type sequence F description binding site for residue JEY A 1201 source : AC1 8) chain A residue 181 type sequence Q description binding site for residue JEY A 1201 source : AC1 9) chain A residue 191 type sequence V description binding site for residue JEY A 1201 source : AC1 10) chain A residue 254 type sequence L description binding site for residue JEY A 1201 source : AC1 11) chain A residue 281 type sequence Y description binding site for residue JEY A 1201 source : AC1 12) chain A residue 285 type sequence Y description binding site for residue JEY A 1201 source : AC1 13) chain A residue 211 type sequence W description binding site for residue OLA A 1202 source : AC2 14) chain A residue 214 type sequence V description binding site for residue OLA A 1202 source : AC2 15) chain A residue 237 type sequence F description binding site for residue OLA A 1202 source : AC2 16) chain A residue 241 type sequence F description binding site for residue OLA A 1202 source : AC2 17) chain A residue 230 type sequence K description binding site for residue PEG A 1203 source : AC3 18) chain A residue 1010 type sequence S description binding site for residue PEG A 1203 source : AC3 19) chain A residue 1011 type sequence Y description binding site for residue PEG A 1203 source : AC3 20) chain A residue 51-63 type TOPO_DOM sequence SVYRNKKLRNAGN description Cytoplasmic => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 124-142 type TOPO_DOM sequence DRYLYICHSLKYDKLYSSK description Cytoplasmic => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 30-50 type TRANSMEM sequence LACVLIFTIVVDILGNLLVIL description Helical; Name=1 => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 162 type BINDING sequence N description BINDING => ECO:0000269|PubMed:31019306, ECO:0007744|PDB:6ME3 source Swiss-Prot : SWS_FT_FI10 24) chain A residue 181 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:31019306, ECO:0007744|PDB:6ME3 source Swiss-Prot : SWS_FT_FI10 25) chain A residue 64-84 type TRANSMEM sequence IFVVSLAVANLVVAIYPYPLV description Helical; Name=2 => ECO:0000255 source Swiss-Prot : SWS_FT_FI3 26) chain A residue 85-102 type TOPO_DOM sequence LMSIFNNGWNFGYLHCQV description Extracellular => ECO:0000255 source Swiss-Prot : SWS_FT_FI4 27) chain A residue 164-187 type TOPO_DOM sequence RAGTLQYDPRIYSCTFAQSVSSAY description Extracellular => ECO:0000255 source Swiss-Prot : SWS_FT_FI4 28) chain A residue 262-274 type TOPO_DOM sequence ASDPASMVPRIPE description Extracellular => ECO:0000255 source Swiss-Prot : SWS_FT_FI4 29) chain A residue 103-123 type TRANSMEM sequence SAFLMGLSVIGSIWNITGIAI description Helical; Name=3 => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 30) chain A residue 143-163 type TRANSMEM sequence NSLCYVLLIWLLTLAAVLPNL description Helical; Name=4 => ECO:0000255 source Swiss-Prot : SWS_FT_FI6 31) chain A residue 188-208 type TRANSMEM sequence TIAVVVFHFLVPMIIVIFCYL description Helical; Name=5 => ECO:0000255 source Swiss-Prot : SWS_FT_FI7 32) chain A residue 241-261 type TRANSMEM sequence FVVFVLFAICFAPLNFIGLAV description Helical; Name=6 => ECO:0000255 source Swiss-Prot : SWS_FT_FI8 33) chain A residue 275-295 type TRANSMEM sequence WLFVASYYMAYFNSCLNPIIY description Helical; Name=7 => ECO:0000255 source Swiss-Prot : SWS_FT_FI9 34) chain A residue 113-129 type prosite sequence GSIWNITGIAIDRYLYI description G_PROTEIN_RECEP_F1_1 G-protein coupled receptors family 1 signature. GSIwNITGIAIDRYLyI source prosite : PS00237

Display surface Download Links