eF-site ID 6mam-I PDB Code 6mam Chain I click to enlarge Title Cleaved Ebola GP in complex with a broadly neutralizing human antibody, ADI-15946 Classification Viral protein/immune system Compound ADI-15946 Fab Heavy Chain Source (VGP_EBOZM) Sequence I:  SIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLE GNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNL EIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDF AFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILP Description Functional site 1) chain I residue 88 type SITE sequence F description Involved in receptor recognition and/or post-binding events => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 2) chain I residue 95 type SITE sequence K description Involved in receptor recognition and/or post-binding events => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 3) chain I residue 170 type SITE sequence I description Involved in receptor recognition and/or post-binding events => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 4) chain I residue 57 type SITE sequence L description Involved in receptor recognition and/or post-binding events => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 5) chain I residue 63 type SITE sequence L description Involved in receptor recognition and/or post-binding events => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 6) chain I residue 64 type SITE sequence R description Involved in receptor recognition and/or post-binding events => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 7) chain I residue 40 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000255 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links