eF-site ID 6kif-p PDB Code 6kif Chain p click to enlarge Title Structure of cyanobacterial photosystem I-IsiA-flavodoxin supercomplex Classification PHOTOSYNTHESIS Compound Photosystem I P700 chlorophyll a apoprotein A1 Source ORGANISM_SCIENTIFIC: Synechococcus elongatus (strain PCC 7942); Sequence p:  AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANAD ASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQG KKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYW PIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWV SQLKSEFGL Description (1)  Chlorophyll a-b binding protein 8, chloroplastic, Chlorophyll a-b binding protein, chloroplastic, Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24, Photosystem II protein D1 (E.C.1.10.3.9), Photosystem II CP47 reaction center protein, Photosystem II CP43 reaction center protein, Photosystem II D2 protein (E.C.1.10.3.9), Cytochrome b559 subunit alpha, Cytochrome b559 subunit beta, PsbF, Photosystem II reaction center protein H, Photosystem II reaction center protein I, PsbI, Photosystem II reaction center protein J, Photosystem II reaction center protein K, Photosystem II reaction center protein L, Photosystem II reaction center protein M, Oxygen-evolving enhancer protein 1, chloroplastic, Oxygen-evolving enhancer protein 2, chloroplastic, Oxygen-evolving enhancer protein 3, Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29, Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26, Photosystem II reaction center protein T, Photosystem II reaction center protein W, PSBW, Photosystem II reaction center protein X, Photosystem II reaction center protein Z Functional site 1) chain p residue 9 type sequence T description binding site for residue FMN p 170 source : DI9 2) chain p residue 10 type sequence Q description binding site for residue FMN p 170 source : DI9 3) chain p residue 11 type sequence T description binding site for residue FMN p 170 source : DI9 4) chain p residue 12 type sequence G description binding site for residue FMN p 170 source : DI9 5) chain p residue 13 type sequence V description binding site for residue FMN p 170 source : DI9 6) chain p residue 14 type sequence T description binding site for residue FMN p 170 source : DI9 7) chain p residue 55 type sequence P description binding site for residue FMN p 170 source : DI9 8) chain p residue 56 type sequence T description binding site for residue FMN p 170 source : DI9 9) chain p residue 57 type sequence W description binding site for residue FMN p 170 source : DI9 10) chain p residue 58 type sequence N description binding site for residue FMN p 170 source : DI9 11) chain p residue 59 type sequence V description binding site for residue FMN p 170 source : DI9 12) chain p residue 60 type sequence G description binding site for residue FMN p 170 source : DI9 13) chain p residue 88 type sequence A description binding site for residue FMN p 170 source : DI9 14) chain p residue 89 type sequence G description binding site for residue FMN p 170 source : DI9 15) chain p residue 90 type sequence D description binding site for residue FMN p 170 source : DI9 16) chain p residue 94 type sequence Y description binding site for residue FMN p 170 source : DI9 17) chain p residue 97 type sequence N description binding site for residue FMN p 170 source : DI9 18) chain p residue 98 type sequence F description binding site for residue FMN p 170 source : DI9 19) chain p residue 99 type sequence Q description binding site for residue FMN p 170 source : DI9 20) chain p residue 146 type sequence D description binding site for residue FMN p 170 source : DI9

Display surface Download Links