eF-site ID 6kif-S PDB Code 6kif Chain S click to enlarge Title Structure of cyanobacterial photosystem I-IsiA-flavodoxin supercomplex Classification PHOTOSYNTHESIS Compound Photosystem I P700 chlorophyll a apoprotein A1 Source ORGANISM_SCIENTIFIC: Synechococcus elongatus (strain PCC 7942); Sequence S:  MSGDFAAAFLPTIFVPLVGLGLPAVLMSLLFTYIESEA Description (1)  Chlorophyll a-b binding protein 8, chloroplastic, Chlorophyll a-b binding protein, chloroplastic, Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24, Photosystem II protein D1 (E.C.1.10.3.9), Photosystem II CP47 reaction center protein, Photosystem II CP43 reaction center protein, Photosystem II D2 protein (E.C.1.10.3.9), Cytochrome b559 subunit alpha, Cytochrome b559 subunit beta, PsbF, Photosystem II reaction center protein H, Photosystem II reaction center protein I, PsbI, Photosystem II reaction center protein J, Photosystem II reaction center protein K, Photosystem II reaction center protein L, Photosystem II reaction center protein M, Oxygen-evolving enhancer protein 1, chloroplastic, Oxygen-evolving enhancer protein 2, chloroplastic, Oxygen-evolving enhancer protein 3, Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29, Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26, Photosystem II reaction center protein T, Photosystem II reaction center protein W, PSBW, Photosystem II reaction center protein X, Photosystem II reaction center protein Z Functional site 1) chain S residue 10 type sequence L description binding site for residue CLA H 1204 source : BR1 2) chain S residue 11 type sequence P description binding site for residue CLA H 1204 source : BR1 3) chain S residue 14 type sequence F description binding site for residue CLA H 1204 source : BR1 4) chain S residue 15 type sequence V description binding site for residue CLA H 1204 source : BR1 5) chain S residue 18 type sequence V description binding site for residue CLA H 1204 source : BR1 6) chain S residue 15 type sequence V description binding site for residue CLA H 1206 source : BR3 7) chain S residue 31 type sequence F description binding site for residue CLA H 1238 source : BU4 8) chain S residue 35 type sequence E description binding site for residue CLA H 1238 source : BU4 9) chain S residue 19 type sequence G description binding site for residue CLA H 1207 source : BU7 10) chain S residue 20 type sequence L description binding site for residue BCR S 4018 source : BW9 11) chain S residue 23 type sequence P description binding site for residue BCR S 4018 source : BW9 12) chain S residue 33 type sequence Y description binding site for residue LHG S 5001 source : BX1 13) chain S residue 27 type sequence M description binding site for residue BCR V 4019 source : BY7 14) chain S residue 30 type sequence L description binding site for residue BCR V 4019 source : BY7 15) chain S residue 31 type sequence F description binding site for residue BCR V 4019 source : BY7 16) chain S residue 13 type sequence I description binding site for residue CLA n 1503 source : DH8 17) chain S residue 12 type sequence T description binding site for residue BCR n 4219 source : DI2 18) chain S residue 13 type sequence I description binding site for residue BCR n 4219 source : DI2 19) chain S residue 26 type sequence L description binding site for residue SQD n 5216 source : DI4 20) chain S residue 29 type sequence L description binding site for residue SQD n 5216 source : DI4 21) chain S residue 32 type sequence T description binding site for residue SQD n 5216 source : DI4 22) chain S residue 36 type sequence S description binding site for residue SQD n 5216 source : DI4 23) chain S residue 21 type sequence G description binding site for residue LHG n 5221 source : DI7

Display surface Download Links