eF-site ID 6kif-R PDB Code 6kif Chain R click to enlarge Title Structure of cyanobacterial photosystem I-IsiA-flavodoxin supercomplex Classification PHOTOSYNTHESIS Compound Photosystem I P700 chlorophyll a apoprotein A1 Source ORGANISM_SCIENTIFIC: Synechococcus elongatus (strain PCC 7942); Sequence R:  DVAGLTPCSESPRFIQRAEAAATPQAKARFENYSQALCGA DGLPHLIVDGRLDHAGDFIIPSLLFLYIAGWIGWVGRSYL QAIKSDKDAAGKEIVIDVPLAVKFSLTGFAWPLAAFQEFS SGKLLAKADEITVSPR Description (1)  Chlorophyll a-b binding protein 8, chloroplastic, Chlorophyll a-b binding protein, chloroplastic, Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24, Photosystem II protein D1 (E.C.1.10.3.9), Photosystem II CP47 reaction center protein, Photosystem II CP43 reaction center protein, Photosystem II D2 protein (E.C.1.10.3.9), Cytochrome b559 subunit alpha, Cytochrome b559 subunit beta, PsbF, Photosystem II reaction center protein H, Photosystem II reaction center protein I, PsbI, Photosystem II reaction center protein J, Photosystem II reaction center protein K, Photosystem II reaction center protein L, Photosystem II reaction center protein M, Oxygen-evolving enhancer protein 1, chloroplastic, Oxygen-evolving enhancer protein 2, chloroplastic, Oxygen-evolving enhancer protein 3, Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29, Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26, Photosystem II reaction center protein T, Photosystem II reaction center protein W, PSBW, Photosystem II reaction center protein X, Photosystem II reaction center protein Z Functional site 1) chain R residue 96 type sequence G description binding site for residue CLA G 1138 source : BN4 2) chain R residue 98 type sequence V description binding site for residue CLA G 1138 source : BN4 3) chain R residue 99 type sequence G description binding site for residue CLA G 1138 source : BN4 4) chain R residue 124 type sequence A description binding site for residue CLA G 1138 source : BN4 5) chain R residue 102 type sequence Y description binding site for residue CLA G 1139 source : BN5 6) chain R residue 103 type sequence L description binding site for residue CLA G 1139 source : BN5 7) chain R residue 116 type sequence E description binding site for residue CLA G 1139 source : BN5 8) chain R residue 125 type sequence V description binding site for residue CLA G 1139 source : BN5 9) chain R residue 117 type sequence I description binding site for residue CLA G 1101 source : BO2 10) chain R residue 148 type sequence L description binding site for residue CLA H 1228 source : BT6 11) chain R residue 81 type sequence F description binding site for residue CLA H 1229 source : BT7 12) chain R residue 85 type sequence S description binding site for residue CLA H 1229 source : BT7 13) chain R residue 88 type sequence F description binding site for residue CLA H 1229 source : BT7 14) chain R residue 92 type sequence A description binding site for residue CLA H 1229 source : BT7 15) chain R residue 71 type sequence V description binding site for residue CLA H 1235 source : BU2 16) chain R residue 81 type sequence F description binding site for residue CLA H 1235 source : BU2 17) chain R residue 85 type sequence S description binding site for residue CLA H 1235 source : BU2 18) chain R residue 56 type sequence Y description binding site for residue CLA H 1230 source : BU8 19) chain R residue 84 type sequence P description binding site for residue BCR H 4014 source : BV7 20) chain R residue 88 type sequence F description binding site for residue BCR H 4014 source : BV7 21) chain R residue 91 type sequence I description binding site for residue BCR H 4014 source : BV7 22) chain R residue 91 type sequence I description binding site for residue CLA R 1301 source : BW6 23) chain R residue 94 type sequence W description binding site for residue CLA R 1301 source : BW6 24) chain R residue 95 type sequence I description binding site for residue CLA R 1301 source : BW6 25) chain R residue 98 type sequence V description binding site for residue CLA R 1301 source : BW6 26) chain R residue 128 type sequence S description binding site for residue CLA R 1301 source : BW6 27) chain R residue 72 type sequence D description binding site for residue CLA R 1302 source : BW7 28) chain R residue 73 type sequence G description binding site for residue CLA R 1302 source : BW7 29) chain R residue 74 type sequence R description binding site for residue CLA R 1302 source : BW7 30) chain R residue 71 type sequence V description binding site for residue BCR R 4016 source : BW8 31) chain R residue 96 type sequence G description binding site for residue BCR R 4016 source : BW8 32) chain R residue 138 type sequence A description binding site for residue BCR R 4016 source : BW8 33) chain R residue 83 type sequence I description binding site for residue CLA T 1303 source : BX3 34) chain R residue 87 type sequence L description binding site for residue CLA T 1303 source : BX3 35) chain R residue 84 type sequence P description binding site for residue BCR T 4015 source : BX5 36) chain R residue 119 type sequence I description binding site for residue LMG T 5104 source : BX7 37) chain R residue 120 type sequence D description binding site for residue LMG T 5104 source : BX7 38) chain R residue 121 type sequence V description binding site for residue LMG T 5104 source : BX7 39) chain R residue 120 type sequence D description binding site for residue LMU T 5105 source : BX8 40) chain R residue 125 type sequence V description binding site for residue LMU T 5105 source : BX8 41) chain R residue 139 type sequence F description binding site for residue BCR b 521 source : CL1 42) chain R residue 140 type sequence Q description binding site for residue SQD b 822 source : CL5

Display surface Download Links