eF-site ID 6kif-E
PDB Code 6kif
Chain E

click to enlarge
Title Structure of cyanobacterial photosystem I-IsiA-flavodoxin supercomplex
Classification PHOTOSYNTHESIS
Compound Photosystem I P700 chlorophyll a apoprotein A1
Source ORGANISM_SCIENTIFIC: Synechococcus elongatus (strain PCC 7942);
Sequence E:  AIARGDKVRILRPESYWFNEVGTVASVDQSGIKYPVVVRF
EKVNYNGFSGSDGGVNTNNFAEAELQVVAAA
Description (1)  Chlorophyll a-b binding protein 8, chloroplastic, Chlorophyll a-b binding protein, chloroplastic, Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24, Photosystem II protein D1 (E.C.1.10.3.9), Photosystem II CP47 reaction center protein, Photosystem II CP43 reaction center protein, Photosystem II D2 protein (E.C.1.10.3.9), Cytochrome b559 subunit alpha, Cytochrome b559 subunit beta, PsbF, Photosystem II reaction center protein H, Photosystem II reaction center protein I, PsbI, Photosystem II reaction center protein J, Photosystem II reaction center protein K, Photosystem II reaction center protein L, Photosystem II reaction center protein M, Oxygen-evolving enhancer protein 1, chloroplastic, Oxygen-evolving enhancer protein 2, chloroplastic, Oxygen-evolving enhancer protein 3, Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29, Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26, Photosystem II reaction center protein T, Photosystem II reaction center protein W, PSBW, Photosystem II reaction center protein X, Photosystem II reaction center protein Z


Functional site

1) chain E
residue 51
type
sequence G
description binding site for residue LHG A 5001
source : AI7


Display surface

Download
Links