eF-site ID 6k1e-A
PDB Code 6k1e
Chain A

click to enlarge
Title Crystal structure of EXD2 exonuclease domain soaked in Mg and GMP
Classification HYDROLASE
Compound Exonuclease 3'-5' domain-containing protein 2
Source (EXD2_HUMAN)
Sequence A:  AKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWVNLES
PLSLLQMASPSGLCVLVRLPKLICGGKTLPRTLLDILADG
TILKVGVGCSEDASKLLQDYGLVVRGCLDLRYLAMRQRNN
LLCNGLSLKSLAETVLNFPLLRCSNWDAETLTEDQVIYAA
RDAQISVALFLHLLGYSSWRKVLEKCQGVVDIPFRS
Description (1)  Exonuclease 3'-5' domain-containing protein 2 (E.C.3.1.11.1)


Functional site

1) chain A
residue 108
type
ligand
sequence D
description binding site for residue MG A 301
source : AC1

2) chain A
residue 108
type
ligand
sequence D
description binding site for residue MG A 302
source : AC2

3) chain A
residue 110
type
ligand
sequence E
description binding site for residue MG A 302
source : AC2

4) chain A
residue 242
type
ligand
sequence Y
description binding site for residue MG B 301
source : AC3

5) chain A
residue 246
type
ligand
sequence D
description binding site for residue MG B 301
source : AC3


Display surface

Download
Links