eF-site ID 6k1e-A PDB Code 6k1e Chain A click to enlarge Title Crystal structure of EXD2 exonuclease domain soaked in Mg and GMP Classification HYDROLASE Compound Exonuclease 3'-5' domain-containing protein 2 Source (EXD2_HUMAN) Sequence A:  AKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWVNLES PLSLLQMASPSGLCVLVRLPKLICGGKTLPRTLLDILADG TILKVGVGCSEDASKLLQDYGLVVRGCLDLRYLAMRQRNN LLCNGLSLKSLAETVLNFPLLRCSNWDAETLTEDQVIYAA RDAQISVALFLHLLGYSSWRKVLEKCQGVVDIPFRS Description Functional site 1) chain A residue 108 type sequence D description binding site for residue MG A 301 source : AC1 2) chain A residue 108 type sequence D description binding site for residue MG A 302 source : AC2 3) chain A residue 110 type sequence E description binding site for residue MG A 302 source : AC2 4) chain A residue 242 type sequence Y description binding site for residue MG B 301 source : AC3 5) chain A residue 246 type sequence D description binding site for residue MG B 301 source : AC3 6) chain A residue 108 type BINDING sequence D description BINDING => ECO:0000269|PubMed:31127291, ECO:0007744|PDB:6K19, ECO:0007744|PDB:6K1A, ECO:0007744|PDB:6K1B, ECO:0007744|PDB:6K1C, ECO:0007744|PDB:6K1D, ECO:0007744|PDB:6K1E source Swiss-Prot : SWS_FT_FI1 7) chain A residue 110 type BINDING sequence E description BINDING => ECO:0000269|PubMed:31127291, ECO:0007744|PDB:6K18, ECO:0007744|PDB:6K1A, ECO:0007744|PDB:6K1B, ECO:0007744|PDB:6K1D, ECO:0007744|PDB:6K1E source Swiss-Prot : SWS_FT_FI2 8) chain A residue 246 type BINDING sequence D description BINDING => ECO:0000269|PubMed:31127291, ECO:0007744|PDB:6K18, ECO:0007744|PDB:6K1A, ECO:0007744|PDB:6K1B, ECO:0007744|PDB:6K1D, ECO:0007744|PDB:6K1E source Swiss-Prot : SWS_FT_FI2

Display surface Download Links