eF-site ID 6k18-AB
PDB Code 6k18
Chain A, B

click to enlarge
Title Crystal structure of EXD2 exonuclease domain soaked in Mn
Classification HYDROLASE
Compound Exonuclease 3'-5' domain-containing protein 2
Source (EXD2_HUMAN)
Sequence A:  KVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWVNLEGK
ASPLSLLQMASPSGLCVLVRLPKLICGGKTLPRTLLDILA
DGTILKVGVGCSEDASKLLQDYGLVVRGCLDLRYLAMRQR
NNLLCNGLSLKSLAETVLNFPLLLRCSNWDAETLTEDQVI
YAARDAQISVALFLHLLGYPSSWRKVLEKCQGVVDIPFR
B:  KVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWVNLSPL
SLLQMASPSGLCVLVRLPKLICGGKTLPRTLLDILADGTI
LKVGVGCSEDASKLLQDYGLVVRGCLDLRYLAMRQRNNLL
CNGLSLKSLAETVLNFPLDLLLRCSNWDAETLTEDQVIYA
ARDAQISVALFLHLLGYPSWRKVLEKCQGVVDIPFR
Description (1)  Exonuclease 3'-5' domain-containing protein 2 (E.C.3.1.11.1)


Functional site

1) chain A
residue 108
type
ligand
sequence D
description binding site for residue MN A 301
source : AC1

2) chain A
residue 110
type
ligand
sequence E
description binding site for residue MN A 301
source : AC1

3) chain B
residue 246
type
ligand
sequence D
description binding site for residue MN A 301
source : AC1

4) chain A
residue 246
type
ligand
sequence D
description binding site for residue MN A 302
source : AC2

5) chain B
residue 108
type
ligand
sequence D
description binding site for residue MN A 302
source : AC2

6) chain B
residue 110
type
ligand
sequence E
description binding site for residue MN A 302
source : AC2


Display surface

Download
Links