eF-site ID 6jyn-D
PDB Code 6jyn
Chain D

click to enlarge
Title GII.13/21 noroviruses recognize glycans with a terminal beta-galactose via an unconventional glycan binding site
Classification VIRAL PROTEIN
Compound human norovirus P domain protein
Source (6JYN)
Sequence D:  TKPFTLPILTISELTNSRFPIPIEQLYTAPNENNVVQCQN
GRCTLDGELQGTTQLLSSAVCSYRGRTVANSGDNWDQNLL
QLTYPSGASYDPTDEVPAPLGTQDFSGILYGVLTQDNVSE
GTGEAKNAKGVYISTTSGKFTPKIGSIGLHSITENVHPNQ
QSRFTPVGVAQNENTPFQQWVLPHYAGALALNTNLAPAVA
PTFPGEELLFFRSRVPCVQGLRGQDAFIDCLLPQEWVNHF
YQEAAPSQADVALIRYVNPDTGRTLFEAKLHRSGFITVSH
TGAYPLVVPPNGHFRFDSWVNQFYSLAPM
Description (1)  P domain protein


Functional site

1) chain D
residue 76
type
ligand
sequence N
description binding site for Poly-Saccharide residues GAL D 601 through NAG D 602
source : AC4

2) chain D
residue 77
type
ligand
sequence W
description binding site for Poly-Saccharide residues GAL D 601 through NAG D 602
source : AC4

3) chain D
residue 136
type
ligand
sequence S
description binding site for Poly-Saccharide residues GAL D 601 through NAG D 602
source : AC4

4) chain D
residue 138
type
ligand
sequence T
description binding site for Poly-Saccharide residues GAL D 601 through NAG D 602
source : AC4

5) chain D
residue 139
type
ligand
sequence S
description binding site for Poly-Saccharide residues GAL D 601 through NAG D 602
source : AC4

6) chain D
residue 174
type
ligand
sequence N
description binding site for Poly-Saccharide residues GAL D 601 through NAG D 602
source : AC4

7) chain D
residue 175
type
ligand
sequence E
description binding site for Poly-Saccharide residues GAL D 601 through NAG D 602
source : AC4

8) chain D
residue 176
type
ligand
sequence N
description binding site for Poly-Saccharide residues GAL D 601 through NAG D 602
source : AC4

9) chain D
residue 177
type
ligand
sequence T
description binding site for Poly-Saccharide residues GAL D 601 through NAG D 602
source : AC4

10) chain D
residue 76-77
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NW
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_D_601

11) chain D
residue 110
type binding
ligand GAL: BETA-D-GALACTOSE
sequence I
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_D_601

12) chain D
residue 136
type binding
ligand GAL: BETA-D-GALACTOSE
sequence S
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_D_601

13) chain D
residue 138-139
type binding
ligand GAL: BETA-D-GALACTOSE
sequence TS
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_D_601

14) chain D
residue 174
type binding
ligand GAL: BETA-D-GALACTOSE
sequence N
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_D_601

15) chain D
residue 176-177
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_D_601

16) chain D
residue 76
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6jyn_D_602

17) chain D
residue 174-176
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NEN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6jyn_D_602


Display surface

Download
Links