eF-site ID 6jyn-A
PDB Code 6jyn
Chain A

click to enlarge
Title GII.13/21 noroviruses recognize glycans with a terminal beta-galactose via an unconventional glycan binding site
Classification VIRAL PROTEIN
Compound human norovirus P domain protein
Source (6JYN)
Sequence A:  TKPFTLPILTISELTNSRFPIPIEQLYTAPNENNVVQCQN
GRCTLDGELQGTTQLLSSAVCSYRGRTVANSGDNWDQNLL
QLTYPSGASYDPTDEVPAPLGTQDFSGILYGVLTQDNVSE
GTGEAKNAKGVYISTTSGKFTPKIGSIGLHSITENVHPNQ
QSRFTPVGVAQNENTPFQQWVLPHYAGALALNTNLAPAVA
PTFPGEELLFFRSRVPCVQGLRGQDAFIDCLLPQEWVNHF
YQEAAPSQADVALIRYVNPDTGRTLFEAKLHRSGFITVSH
TGAYPLVVPPNGHFRFDSWVNQFYSLAPM
Description (1)  P domain protein


Functional site

1) chain A
residue 76
type
ligand
sequence N
description binding site for Poly-Saccharide residues GAL A 601 through NAG A 602
source : AC1

2) chain A
residue 77
type
ligand
sequence W
description binding site for Poly-Saccharide residues GAL A 601 through NAG A 602
source : AC1

3) chain A
residue 136
type
ligand
sequence S
description binding site for Poly-Saccharide residues GAL A 601 through NAG A 602
source : AC1

4) chain A
residue 138
type
ligand
sequence T
description binding site for Poly-Saccharide residues GAL A 601 through NAG A 602
source : AC1

5) chain A
residue 139
type
ligand
sequence S
description binding site for Poly-Saccharide residues GAL A 601 through NAG A 602
source : AC1

6) chain A
residue 174
type
ligand
sequence N
description binding site for Poly-Saccharide residues GAL A 601 through NAG A 602
source : AC1

7) chain A
residue 175
type
ligand
sequence E
description binding site for Poly-Saccharide residues GAL A 601 through NAG A 602
source : AC1

8) chain A
residue 176
type
ligand
sequence N
description binding site for Poly-Saccharide residues GAL A 601 through NAG A 602
source : AC1

9) chain A
residue 177
type
ligand
sequence T
description binding site for Poly-Saccharide residues GAL A 601 through NAG A 602
source : AC1

10) chain A
residue 76-77
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NW
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_A_601

11) chain A
residue 110
type binding
ligand GAL: BETA-D-GALACTOSE
sequence I
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_A_601

12) chain A
residue 136
type binding
ligand GAL: BETA-D-GALACTOSE
sequence S
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_A_601

13) chain A
residue 138-140
type binding
ligand GAL: BETA-D-GALACTOSE
sequence TSG
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_A_601

14) chain A
residue 174
type binding
ligand GAL: BETA-D-GALACTOSE
sequence N
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_A_601

15) chain A
residue 176-177
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_6jyn_A_601

16) chain A
residue 174-176
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NEN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6jyn_A_602


Display surface

Download
Links