eF-site ID 6jqs-A
PDB Code 6jqs
Chain A

click to enlarge
Title Structure of Transcription factor, GerE
Classification DNA BINDING PROTEIN
Compound DNA-binding response regulator
Source (6JQS)
Sequence A:  RSLLTGREREIFQLLVRDYSTKDISIQLKISEKTVRNHIS
NTIQKLGVSGRSQAILELLRLGELSLD
Description (1)  DNA-binding response regulator

Display surface

Download
Links