eF-site ID 6jqs-A
PDB Code 6jqs
Chain A

click to enlarge
Title Structure of Transcription factor, GerE
Classification DNA BINDING PROTEIN
Compound DNA-binding response regulator
Source (6JQS)
Sequence A:  RSLLTGREREIFQLLVRDYSTKDISIQLKISEKTVRNHIS
NTIQKLGVSGRSQAILELLRLGELSLD
Description (1)  DNA-binding response regulator


Functional site

1) chain A
residue 26-53
type prosite
ligand
sequence DYSTKDISIQLKISEKTVRNHISNTIQK
description LuxR-type HTH domain signature.[GDC]-x(2)-[NSTAVY]-x(2)-[IV]-[GSTA]-x(2)-[LIVMFYWCT]-x-[LIVMFYWCR]-x(3)-[NST]-[LIVM]-x(2)-{T}-x(2)-[NRHSA]-[LIVMSTA]-x(2)-[KR].
source prosite : PS00622


Display surface

Download
Links