eF-site ID 6jp2-ABCD
PDB Code 6jp2
Chain A, B, C, D

click to enlarge
Title Crystal structure of pyrrolysyl-tRNA synthetase from Methanomethylophilus alvus
Classification TRANSLATION,LIGASE
Compound Pyrrolysyl-tRNA synthetase
Source (M9SC49_METAX)
Sequence A:  SHMTVKYTDAQIQRLREYGNGTYEQKVFEDLASRDAAFSK
EMSVASTDNEKKIKGMIANPSRHGLTQLMNDIADALVAEG
FIEVRTPIFISKDALARMTITEDKPLFKQVFWIDEKRALR
PMLAPNLYSVMRDLRDHTDGPVKIFEMGSCFRKESHSGMH
LEEFTMLNLVDMGPRGDATEVLKNYISVVMKAAGLPDYDL
VQEESDVYKETIDVEINGQEVCSAAVGPHYLDAAHDVHEP
WSGAGFGLERLLTIREKYSTVKKGGASISYLNGAKIN
B:  MTVKYTDAQIQRLREYGNGTYEQKVFEDLASRDAAFSKEM
SVASTDNEKKIKGMIANPSRHGLTQLMNDIADALVAEGFI
EVRTPIFISKDALARMTITEDKPLFKQVFWIDEKRALRPM
LAPNLYSVMRDLRDHTDGPVKIFEMGSCFRKESMHLEEFT
MLNLVDMGPRGDATEVLKNYISVVMKAAGLPDYDLVQEES
DVYKETIDVEINGQEVCSAAVGPHYLDAAHDVHEPWSGAG
FGLERLLTIREKYSTVKKGGASISYLNGAKIN
C:  HMTVKYTDAQIQRLREYGNGTYEQKVFEDLASRDAAFSKE
MSVASTDNEKKIKGMIANPSRHGLTQLMNDIADALVAEGF
IEVRTPIFISKDALARMTITEDKPLFKQVFWIDEKRALRP
MLAPNLYSVMRDLRDHTDGPVKIFEMGSCFRKESHSGMHL
EEFTMLNLVDMGPRGDATEVLKNYISVVMKAAGLPDYDLV
QEESDVYKETIDVEINGQEVCSAAVGPHYLDAAHDVHEPW
SGAGFGLERLLTIREKYSTVKKGGASISYLNGAKIN
D:  HMTVKYTDAQIQRLREYGNGTYEQKVFSRDAAFSKEMSVA
STDNEKKIKGMIANPSRHGLTQLMNDIADALVAEGFIEVR
TPIFISKDALARMTITEDKPLFKQVFWIDEKRALRPMLAP
NLYSVMRDLRDHTDGPVKIFEMGSCFRKESHSGMHLEEFT
MLNLVDMGPRGDATEVLKNYISVVMKAAGLPDYDLVQEES
DVYKETIDVEINGQEVCSAAVGPHYLDAAHDVHEPWSGAG
FGLERLLTIREKYSTVKKGGASISYLNGAKIN
Description (1)  Pyrrolysyl-tRNA synthetase (E.C.6.1.1.26)

Display surface

Download
Links