eF-site ID 6jp2-A
PDB Code 6jp2
Chain A

click to enlarge
Title Crystal structure of pyrrolysyl-tRNA synthetase from Methanomethylophilus alvus
Classification TRANSLATION,LIGASE
Compound Pyrrolysyl-tRNA synthetase
Source (M9SC49_METAX)
Sequence A:  SHMTVKYTDAQIQRLREYGNGTYEQKVFEDLASRDAAFSK
EMSVASTDNEKKIKGMIANPSRHGLTQLMNDIADALVAEG
FIEVRTPIFISKDALARMTITEDKPLFKQVFWIDEKRALR
PMLAPNLYSVMRDLRDHTDGPVKIFEMGSCFRKESHSGMH
LEEFTMLNLVDMGPRGDATEVLKNYISVVMKAAGLPDYDL
VQEESDVYKETIDVEINGQEVCSAAVGPHYLDAAHDVHEP
WSGAGFGLERLLTIREKYSTVKKGGASISYLNGAKIN
Description (1)  Pyrrolysyl-tRNA synthetase (E.C.6.1.1.26)

Display surface

Download
Links