eF-site ID 6jm9-D PDB Code 6jm9 Chain D click to enlarge Title cryo-EM structure of DOT1L bound to unmodified nucleosome Classification GENE REGULATION Compound DNA strand I Source (DOT1L_HUMAN) Sequence D:  TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFE RIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV SEGTKAVTKYTSAK Description Functional site 1) chain D residue 89-111 type prosite sequence REIQTAVRLLLPGELAKHAVSEG description HISTONE_H2B Histone H2B signature. REIQTavRlLLpGELaKHAVSEG source prosite : PS00357

Display surface Download Links