eF-site ID 6jkw-H
PDB Code 6jkw
Chain H

click to enlarge
Title Seleno-methionine PNGM-1 from deep-sea sediment metagenome
Classification TRANSFERASE
Compound Metallo-beta-lactamases PNGM-1
Source (6JKW)
Sequence H:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
Description (1)  Metallo-beta-lactamases PNGM-1


Functional site

1) chain H
residue 95
type
ligand
sequence D
description binding site for residue ZN H 401
source : AD6

2) chain H
residue 96
type
ligand
sequence H
description binding site for residue ZN H 401
source : AD6

3) chain H
residue 210
type
ligand
sequence D
description binding site for residue ZN H 401
source : AD6

4) chain H
residue 279
type
ligand
sequence H
description binding site for residue ZN H 401
source : AD6

5) chain H
residue 91
type
ligand
sequence H
description binding site for residue ZN H 402
source : AD7

6) chain H
residue 93
type
ligand
sequence H
description binding site for residue ZN H 402
source : AD7

7) chain H
residue 188
type
ligand
sequence H
description binding site for residue ZN H 402
source : AD7

8) chain H
residue 210
type
ligand
sequence D
description binding site for residue ZN H 402
source : AD7


Display surface

Download
Links