eF-site ID 6jkw-G
PDB Code 6jkw
Chain G

click to enlarge
Title Seleno-methionine PNGM-1 from deep-sea sediment metagenome
Classification TRANSFERASE
Compound Metallo-beta-lactamases PNGM-1
Source (6JKW)
Sequence G:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
Description (1)  Metallo-beta-lactamases PNGM-1


Functional site

1) chain G
residue 95
type
ligand
sequence D
description binding site for residue ZN G 401
source : AD4

2) chain G
residue 96
type
ligand
sequence H
description binding site for residue ZN G 401
source : AD4

3) chain G
residue 210
type
ligand
sequence D
description binding site for residue ZN G 401
source : AD4

4) chain G
residue 279
type
ligand
sequence H
description binding site for residue ZN G 401
source : AD4

5) chain G
residue 91
type
ligand
sequence H
description binding site for residue ZN G 402
source : AD5

6) chain G
residue 93
type
ligand
sequence H
description binding site for residue ZN G 402
source : AD5

7) chain G
residue 188
type
ligand
sequence H
description binding site for residue ZN G 402
source : AD5

8) chain G
residue 210
type
ligand
sequence D
description binding site for residue ZN G 402
source : AD5


Display surface

Download
Links