eF-site ID 6jkw-F
PDB Code 6jkw
Chain F

click to enlarge
Title Seleno-methionine PNGM-1 from deep-sea sediment metagenome
Classification TRANSFERASE
Compound Metallo-beta-lactamases PNGM-1
Source (6JKW)
Sequence F:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
Description (1)  Metallo-beta-lactamases PNGM-1


Functional site

1) chain F
residue 95
type
ligand
sequence D
description binding site for residue ZN F 401
source : AD2

2) chain F
residue 96
type
ligand
sequence H
description binding site for residue ZN F 401
source : AD2

3) chain F
residue 210
type
ligand
sequence D
description binding site for residue ZN F 401
source : AD2

4) chain F
residue 279
type
ligand
sequence H
description binding site for residue ZN F 401
source : AD2

5) chain F
residue 91
type
ligand
sequence H
description binding site for residue ZN F 402
source : AD3

6) chain F
residue 93
type
ligand
sequence H
description binding site for residue ZN F 402
source : AD3

7) chain F
residue 188
type
ligand
sequence H
description binding site for residue ZN F 402
source : AD3

8) chain F
residue 210
type
ligand
sequence D
description binding site for residue ZN F 402
source : AD3


Display surface

Download
Links