eF-site ID 6jkw-E
PDB Code 6jkw
Chain E

click to enlarge
Title Seleno-methionine PNGM-1 from deep-sea sediment metagenome
Classification TRANSFERASE
Compound Metallo-beta-lactamases PNGM-1
Source (6JKW)
Sequence E:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
Description (1)  Metallo-beta-lactamases PNGM-1


Functional site

1) chain E
residue 95
type
ligand
sequence D
description binding site for residue ZN E 401
source : AC9

2) chain E
residue 96
type
ligand
sequence H
description binding site for residue ZN E 401
source : AC9

3) chain E
residue 210
type
ligand
sequence D
description binding site for residue ZN E 401
source : AC9

4) chain E
residue 279
type
ligand
sequence H
description binding site for residue ZN E 401
source : AC9

5) chain E
residue 91
type
ligand
sequence H
description binding site for residue ZN E 402
source : AD1

6) chain E
residue 93
type
ligand
sequence H
description binding site for residue ZN E 402
source : AD1

7) chain E
residue 188
type
ligand
sequence H
description binding site for residue ZN E 402
source : AD1

8) chain E
residue 210
type
ligand
sequence D
description binding site for residue ZN E 402
source : AD1


Display surface

Download
Links