eF-site ID 6jkw-D
PDB Code 6jkw
Chain D

click to enlarge
Title Seleno-methionine PNGM-1 from deep-sea sediment metagenome
Classification TRANSFERASE
Compound Metallo-beta-lactamases PNGM-1
Source (6JKW)
Sequence D:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
Description (1)  Metallo-beta-lactamases PNGM-1


Functional site

1) chain D
residue 95
type
ligand
sequence D
description binding site for residue ZN D 401
source : AC7

2) chain D
residue 96
type
ligand
sequence H
description binding site for residue ZN D 401
source : AC7

3) chain D
residue 210
type
ligand
sequence D
description binding site for residue ZN D 401
source : AC7

4) chain D
residue 279
type
ligand
sequence H
description binding site for residue ZN D 401
source : AC7

5) chain D
residue 91
type
ligand
sequence H
description binding site for residue ZN D 402
source : AC8

6) chain D
residue 93
type
ligand
sequence H
description binding site for residue ZN D 402
source : AC8

7) chain D
residue 188
type
ligand
sequence H
description binding site for residue ZN D 402
source : AC8

8) chain D
residue 210
type
ligand
sequence D
description binding site for residue ZN D 402
source : AC8


Display surface

Download
Links