eF-site ID 6jkw-C
PDB Code 6jkw
Chain C

click to enlarge
Title Seleno-methionine PNGM-1 from deep-sea sediment metagenome
Classification TRANSFERASE
Compound Metallo-beta-lactamases PNGM-1
Source (6JKW)
Sequence C:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
Description (1)  Metallo-beta-lactamases PNGM-1


Functional site

1) chain C
residue 95
type
ligand
sequence D
description binding site for residue ZN C 401
source : AC5

2) chain C
residue 96
type
ligand
sequence H
description binding site for residue ZN C 401
source : AC5

3) chain C
residue 210
type
ligand
sequence D
description binding site for residue ZN C 401
source : AC5

4) chain C
residue 279
type
ligand
sequence H
description binding site for residue ZN C 401
source : AC5

5) chain C
residue 91
type
ligand
sequence H
description binding site for residue ZN C 402
source : AC6

6) chain C
residue 93
type
ligand
sequence H
description binding site for residue ZN C 402
source : AC6

7) chain C
residue 188
type
ligand
sequence H
description binding site for residue ZN C 402
source : AC6

8) chain C
residue 210
type
ligand
sequence D
description binding site for residue ZN C 402
source : AC6


Display surface

Download
Links