eF-site ID 6jkw-B
PDB Code 6jkw
Chain B

click to enlarge
Title Seleno-methionine PNGM-1 from deep-sea sediment metagenome
Classification TRANSFERASE
Compound Metallo-beta-lactamases PNGM-1
Source (6JKW)
Sequence B:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
Description (1)  Metallo-beta-lactamases PNGM-1


Functional site

1) chain B
residue 95
type
ligand
sequence D
description binding site for residue ZN B 401
source : AC3

2) chain B
residue 96
type
ligand
sequence H
description binding site for residue ZN B 401
source : AC3

3) chain B
residue 210
type
ligand
sequence D
description binding site for residue ZN B 401
source : AC3

4) chain B
residue 279
type
ligand
sequence H
description binding site for residue ZN B 401
source : AC3

5) chain B
residue 91
type
ligand
sequence H
description binding site for residue ZN B 402
source : AC4

6) chain B
residue 93
type
ligand
sequence H
description binding site for residue ZN B 402
source : AC4

7) chain B
residue 188
type
ligand
sequence H
description binding site for residue ZN B 402
source : AC4

8) chain B
residue 210
type
ligand
sequence D
description binding site for residue ZN B 402
source : AC4


Display surface

Download
Links