eF-site ID 6jkw-ABCDEFGH
PDB Code 6jkw
Chain A, B, C, D, E, F, G, H
Title Seleno-methionine PNGM-1 from deep-sea sediment metagenome
Classification TRANSFERASE
Compound Metallo-beta-lactamases PNGM-1
Source (6JKW)
Sequence A:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
B:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
C:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
D:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
E:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
F:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
G:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
H:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
Description (1)  Metallo-beta-lactamases PNGM-1


Functional site

1) chain A
residue 95
type
ligand
sequence D
description binding site for residue ZN A 401
source : AC1

2) chain A
residue 96
type
ligand
sequence H
description binding site for residue ZN A 401
source : AC1

3) chain A
residue 210
type
ligand
sequence D
description binding site for residue ZN A 401
source : AC1

4) chain A
residue 279
type
ligand
sequence H
description binding site for residue ZN A 401
source : AC1

5) chain A
residue 91
type
ligand
sequence H
description binding site for residue ZN A 402
source : AC2

6) chain A
residue 93
type
ligand
sequence H
description binding site for residue ZN A 402
source : AC2

7) chain A
residue 188
type
ligand
sequence H
description binding site for residue ZN A 402
source : AC2

8) chain A
residue 210
type
ligand
sequence D
description binding site for residue ZN A 402
source : AC2

9) chain B
residue 95
type
ligand
sequence D
description binding site for residue ZN B 401
source : AC3

10) chain B
residue 96
type
ligand
sequence H
description binding site for residue ZN B 401
source : AC3

11) chain B
residue 210
type
ligand
sequence D
description binding site for residue ZN B 401
source : AC3

12) chain B
residue 279
type
ligand
sequence H
description binding site for residue ZN B 401
source : AC3

13) chain B
residue 91
type
ligand
sequence H
description binding site for residue ZN B 402
source : AC4

14) chain B
residue 93
type
ligand
sequence H
description binding site for residue ZN B 402
source : AC4

15) chain B
residue 188
type
ligand
sequence H
description binding site for residue ZN B 402
source : AC4

16) chain B
residue 210
type
ligand
sequence D
description binding site for residue ZN B 402
source : AC4

17) chain C
residue 95
type
ligand
sequence D
description binding site for residue ZN C 401
source : AC5

18) chain C
residue 96
type
ligand
sequence H
description binding site for residue ZN C 401
source : AC5

19) chain C
residue 210
type
ligand
sequence D
description binding site for residue ZN C 401
source : AC5

20) chain C
residue 279
type
ligand
sequence H
description binding site for residue ZN C 401
source : AC5

21) chain C
residue 91
type
ligand
sequence H
description binding site for residue ZN C 402
source : AC6

22) chain C
residue 93
type
ligand
sequence H
description binding site for residue ZN C 402
source : AC6

23) chain C
residue 188
type
ligand
sequence H
description binding site for residue ZN C 402
source : AC6

24) chain C
residue 210
type
ligand
sequence D
description binding site for residue ZN C 402
source : AC6

25) chain D
residue 95
type
ligand
sequence D
description binding site for residue ZN D 401
source : AC7

26) chain D
residue 96
type
ligand
sequence H
description binding site for residue ZN D 401
source : AC7

27) chain D
residue 210
type
ligand
sequence D
description binding site for residue ZN D 401
source : AC7

28) chain D
residue 279
type
ligand
sequence H
description binding site for residue ZN D 401
source : AC7

29) chain D
residue 91
type
ligand
sequence H
description binding site for residue ZN D 402
source : AC8

30) chain D
residue 93
type
ligand
sequence H
description binding site for residue ZN D 402
source : AC8

31) chain D
residue 188
type
ligand
sequence H
description binding site for residue ZN D 402
source : AC8

32) chain D
residue 210
type
ligand
sequence D
description binding site for residue ZN D 402
source : AC8

33) chain E
residue 95
type
ligand
sequence D
description binding site for residue ZN E 401
source : AC9

34) chain E
residue 96
type
ligand
sequence H
description binding site for residue ZN E 401
source : AC9

35) chain E
residue 210
type
ligand
sequence D
description binding site for residue ZN E 401
source : AC9

36) chain E
residue 279
type
ligand
sequence H
description binding site for residue ZN E 401
source : AC9

37) chain E
residue 91
type
ligand
sequence H
description binding site for residue ZN E 402
source : AD1

38) chain E
residue 93
type
ligand
sequence H
description binding site for residue ZN E 402
source : AD1

39) chain E
residue 188
type
ligand
sequence H
description binding site for residue ZN E 402
source : AD1

40) chain E
residue 210
type
ligand
sequence D
description binding site for residue ZN E 402
source : AD1

41) chain F
residue 95
type
ligand
sequence D
description binding site for residue ZN F 401
source : AD2

42) chain F
residue 96
type
ligand
sequence H
description binding site for residue ZN F 401
source : AD2

43) chain F
residue 210
type
ligand
sequence D
description binding site for residue ZN F 401
source : AD2

44) chain F
residue 279
type
ligand
sequence H
description binding site for residue ZN F 401
source : AD2

45) chain F
residue 91
type
ligand
sequence H
description binding site for residue ZN F 402
source : AD3

46) chain F
residue 93
type
ligand
sequence H
description binding site for residue ZN F 402
source : AD3

47) chain F
residue 188
type
ligand
sequence H
description binding site for residue ZN F 402
source : AD3

48) chain F
residue 210
type
ligand
sequence D
description binding site for residue ZN F 402
source : AD3

49) chain G
residue 95
type
ligand
sequence D
description binding site for residue ZN G 401
source : AD4

50) chain G
residue 96
type
ligand
sequence H
description binding site for residue ZN G 401
source : AD4

51) chain G
residue 210
type
ligand
sequence D
description binding site for residue ZN G 401
source : AD4

52) chain G
residue 279
type
ligand
sequence H
description binding site for residue ZN G 401
source : AD4

53) chain G
residue 91
type
ligand
sequence H
description binding site for residue ZN G 402
source : AD5

54) chain G
residue 93
type
ligand
sequence H
description binding site for residue ZN G 402
source : AD5

55) chain G
residue 188
type
ligand
sequence H
description binding site for residue ZN G 402
source : AD5

56) chain G
residue 210
type
ligand
sequence D
description binding site for residue ZN G 402
source : AD5

57) chain H
residue 95
type
ligand
sequence D
description binding site for residue ZN H 401
source : AD6

58) chain H
residue 96
type
ligand
sequence H
description binding site for residue ZN H 401
source : AD6

59) chain H
residue 210
type
ligand
sequence D
description binding site for residue ZN H 401
source : AD6

60) chain H
residue 279
type
ligand
sequence H
description binding site for residue ZN H 401
source : AD6

61) chain H
residue 91
type
ligand
sequence H
description binding site for residue ZN H 402
source : AD7

62) chain H
residue 93
type
ligand
sequence H
description binding site for residue ZN H 402
source : AD7

63) chain H
residue 188
type
ligand
sequence H
description binding site for residue ZN H 402
source : AD7

64) chain H
residue 210
type
ligand
sequence D
description binding site for residue ZN H 402
source : AD7


Display surface

Download
Links