eF-site ID 6jkw-A
PDB Code 6jkw
Chain A

click to enlarge
Title Seleno-methionine PNGM-1 from deep-sea sediment metagenome
Classification TRANSFERASE
Compound Metallo-beta-lactamases PNGM-1
Source (6JKW)
Sequence A:  AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGXP
TARRAQAAAAWVVELGNGDKFIVDIGSGSXANIQSLXIPA
NYLTKIFLTHLHTDHWGDLVSXWAGGWTAGRTDPLEVWGP
SGSREDXGTKYAVEHXLKAYNWDYXTRAVTINPRPGDINV
HEFDYRALNEVVYQENGVTFRSWPCIHAGDGPVSFALEWN
GYKVVFGGDTAPNIWYPEYAKGADLAIHECWXTSDQXXTK
YNQPAQLALRINLDFHTSAQSFGQIXNXVQPRHAVAYHFF
NDDDTRYDIYTGVRENYAGPLSXATDXXVWNITRDAVTER
XAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFXG
Description (1)  Metallo-beta-lactamases PNGM-1


Functional site

1) chain A
residue 95
type
ligand
sequence D
description binding site for residue ZN A 401
source : AC1

2) chain A
residue 96
type
ligand
sequence H
description binding site for residue ZN A 401
source : AC1

3) chain A
residue 210
type
ligand
sequence D
description binding site for residue ZN A 401
source : AC1

4) chain A
residue 279
type
ligand
sequence H
description binding site for residue ZN A 401
source : AC1

5) chain A
residue 91
type
ligand
sequence H
description binding site for residue ZN A 402
source : AC2

6) chain A
residue 93
type
ligand
sequence H
description binding site for residue ZN A 402
source : AC2

7) chain A
residue 188
type
ligand
sequence H
description binding site for residue ZN A 402
source : AC2

8) chain A
residue 210
type
ligand
sequence D
description binding site for residue ZN A 402
source : AC2


Display surface

Download
Links