eF-site ID 6jj1-A PDB Code 6jj1 Chain A click to enlarge Title Crystal structure of peptidyl-tRNA hydrolase from Acinetobacter baumannii at 0.97 A resolution with disordered five N-terminal residues Classification HYDROLASE Compound Peptidyl-tRNA hydrolase Source (D0C9L6_ACIB2) Sequence A:  GSHMSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYG ITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVV PFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNG LRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNE QSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA Description Functional site 1) chain A residue 94 type sequence H description binding site for residue CL A 201 source : AC1 2) chain A residue 131 type sequence R description binding site for residue CL A 201 source : AC1 3) chain A residue 12 type sequence N description binding site for residue CL A 202 source : AC2 4) chain A residue 22 type sequence H description binding site for residue CL A 202 source : AC2 5) chain A residue 116 type sequence N description binding site for residue CL A 202 source : AC2 6) chain A residue 133 type sequence R description binding site for residue CL A 203 source : AC3 7) chain A residue 30 type sequence E description binding site for residue EDO A 204 source : AC4 8) chain A residue 17-30 type prosite sequence YAQTRHNAGFWFVE description PEPT_TRNA_HYDROL_1 Peptidyl-tRNA hydrolase signature 1. YaqTRHNaGfwFVE source prosite : PS01195 9) chain A residue 111-121 type prosite sequence GHGGHNGLRDI description PEPT_TRNA_HYDROL_2 Peptidyl-tRNA hydrolase signature 2. GhggHNGLRDI source prosite : PS01196

Display surface Download Links