eF-site ID 6jgh-A PDB Code 6jgh Chain A click to enlarge Title Crystal structure of the F99S/M153T/V163A/T203I variant of GFP at 0.94 A Classification FLUORESCENT PROTEIN Compound Green fluorescent protein Source (GFP_AEQVI) Sequence A:  SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGK LTLKFICTTGKLPVPWPTLVTTFXVQCFSRYPDHMKRHDF FKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRI ELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKA NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSI QSALSKDPNEKRDHMVLLEFVTAAGITH Description Functional site 1) chain A residue 56 type sequence P description binding site for residue CL A 301 source : AC1 2) chain A residue 57 type sequence W description binding site for residue CL A 301 source : AC1 3) chain A residue 58 type sequence P description binding site for residue CL A 301 source : AC1 4) chain A residue 143 type sequence Y description binding site for residue CL A 301 source : AC1 5) chain A residue 68 type MOD_RES sequence V description (Z)-2,3-didehydrotyrosine => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 66 type CROSSLNK sequence X description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 69 type CROSSLNK sequence Q description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links