eF-site ID 6j7j-A PDB Code 6j7j Chain A click to enlarge Title Crystal structure of Pseudomonas aeruginosa Earp Classification TRANSFERASE Compound Pseudomonas aeruginosa Earp Source (Q9HZZ1_PSEAE) Sequence A:  FQHXASWDIFCSVGDIGVTWRLARQLAAEHGQAVRLWVDE PQAFARICPRADPVAHVQCLDGVEVRAWGRPWAPVAAADV VIEAFACELPEAHRQAXRERKRPSLWLNLEYLSAEEWIGS CHALPSLQACGLSKYFFFPGFREPSGGLLREAGLLERRRR FQASVSAQDEFLASLGVRRKVGERLISLFAYENPALPGWL EQLRDARQPSLLLVPEGRVLADVADWLRVATLAVGDVHVR DALRVQVLPFXAQDDYDRLLWCCDLNAVRGEDSFVRAQWA GRPLLWHIYHLAKLEAFLELYCAGLPADLAENLRTFWLAW NAGGGLAGAWEGLERQLPEWRREAQRWADEQGXRPDLAAR LVQFYADWLLEHHHHHH Description (1)  Pseudomonas aeruginosa Earp Functional site 1) chain A residue 75 type sequence P description binding site for residue MES A 401 source : AC1 2) chain A residue 180 type sequence R description binding site for residue MES A 401 source : AC1 3) chain A residue 183 type sequence G description binding site for residue MES A 401 source : AC1 4) chain A residue 184 type sequence E description binding site for residue MES A 401 source : AC1 5) chain A residue 185 type sequence R description binding site for residue MES A 401 source : AC1 6) chain A residue 265 type sequence D description binding site for residue MES A 401 source : AC1 7) chain A residue 345 type sequence P description binding site for residue MES A 401 source : AC1 8) chain A residue 348 type sequence R description binding site for residue MES A 401 source : AC1 9) chain A residue 16 type ACT_SITE sequence D description Proton acceptor => ECO:0000269|PubMed:31010899 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 272 type ACT_SITE sequence E description ACT_SITE => ECO:0000269|PubMed:31010899 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 192 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:31010899, ECO:0007744|PDB:6J7K source Swiss-Prot : SWS_FT_FI3 12) chain A residue 252 type BINDING sequence X description BINDING => ECO:0000269|PubMed:31010899, ECO:0007744|PDB:6J7K source Swiss-Prot : SWS_FT_FI3 13) chain A residue 270 type BINDING sequence R description BINDING => ECO:0000269|PubMed:31010899, ECO:0007744|PDB:6J7K source Swiss-Prot : SWS_FT_FI3

Display surface Download Links