eF-site ID 6j7c-A PDB Code 6j7c Chain A click to enlarge Title Crystal structure of proline racemase-like protein from Thermococcus litoralis in complex with proline Classification ISOMERASE Compound Proline racemase Source (H3ZMH5_THELN) Sequence A:  LFADHVFHVVDTHTEGEPTRIVLSGVNVKGEDIIEKREYF KEHYDWIRTALLHEPRGHSDQFGAVLVPSDIADFGVIYMD TSGYLDMCGHATMGVATVLVELGIIEKKEPYTTVKLETPA GLVEAKAKVKGGVVKEVTVVDVPSFYVGEFVIEYPGRGKI KVDVAFGGNFYVIADARDLGLRVRREYIKELIPTALKLIK VANEQIKVQHPRKGVQNRINLAMLTDEPEREDSDGKNVVI WGEGSVDRSPCGTGSASRVATLYSKGILKEGDIFVHESIL GTQFRIKIVGTTKIGEYTAIIPEITGSAYITKISQDIISK NDPLWKGFLLR Description Functional site 1) chain A residue 88 type sequence C description binding site for residue PRO A 401 source : AC1 2) chain A residue 89 type sequence G description binding site for residue PRO A 401 source : AC1 3) chain A residue 90 type sequence H description binding site for residue PRO A 401 source : AC1 4) chain A residue 241 type sequence W description binding site for residue PRO A 401 source : AC1 5) chain A residue 247 type sequence D description binding site for residue PRO A 401 source : AC1 6) chain A residue 251 type sequence C description binding site for residue PRO A 401 source : AC1 7) chain A residue 252 type sequence G description binding site for residue PRO A 401 source : AC1 8) chain A residue 253 type sequence T description binding site for residue PRO A 401 source : AC1

Display surface Download Links