eF-site ID 6j6n-s
PDB Code 6j6n
Chain s

click to enlarge
Title Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom
Classification SPLICING
Compound Pre-mRNA-splicing factor 8
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae S288c;
Sequence s:  KIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMN
LVLNECIEERVPKTQLDKLRPRTLNIKVEKRVLGLTILRG
EQILSTVVEDKPL
Description (1)  Pre-mRNA-splicing factor 8, Pre-mRNA-splicing factor SNU114, Pre-mRNA-splicing factor CWC21, Pre-mRNA-splicing factor PRP46, Pre-mRNA-processing protein 45, Pre-mRNA-splicing factor SLT11, Pre-mRNA-splicing factor CWC2, Pre-mRNA-splicing factor CWC15, Pre-mRNA-splicing factor BUD31, Pre-mRNA-splicing factor CWC22, Pre-mRNA-splicing factor CEF1, Pre-mRNA-splicing factor CLF1, Pre-mRNA-splicing factor SYF2, Pre-mRNA-processing factor 17, Pre-mRNA-splicing factor ISY1, Pre-mRNA-splicing factor SYF1, U2 small nuclear ribonucleoprotein B'', U2 small nuclear ribonucleoprotein A', Pre-mRNA-splicing factor SNT309, Small nuclear ribonucleoprotein E, Small nuclear ribonucleoprotein Sm D1, Small nuclear ribonucleoprotein G, Small nuclear ribonucleoprotein F, Small nuclear ribonucleoprotein Sm D2, Small nuclear ribonucleoprotein-associated protein B, Small nuclear ribonucleoprotein Sm D3, Pre-mRNA-processing factor 19/RNA Complex

Display surface

Download
Links