eF-site ID 6iqw-E
PDB Code 6iqw
Chain E

click to enlarge
Title Cryo-EM structure of Csm effector complex
Classification RNA BINDING PROTEIN/RNA
Compound Csm1
Source (6IQW)
Sequence E:  PKFIAVKLIPKGPFRDIPRADTLFGAIGNAISAIHGQSAV
EELVDAFVGGARISSAFPYSGDTYYLPKPLSVEPALEGIL
TGLDEEERYTTAKRLRKAKYLDLKNFELALRLRPFTIPEE
IPYARVDVPRVVLDRVTQDSSIYFWEEIRFREKSGVYFLY
SGPREVFDGYIAPAMRFLGWGAGLFEVEFHEMKIDAPGSE
YSVTLSNALPTKTPVLWRLLRKGGWSFGRRKPRMTFIAEG
SIVKNDPGGMERLELGLSHEVYVYGLTFPLGVELPEG
Description (1)  Csm1, Csm2, Csm3, Csm4, Csm5/RNA Complex


Functional site

1) chain E
residue 93
type
ligand
sequence A
description binding site for residue ATP A 801
source : AC1

2) chain E
residue 89
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence R
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

3) chain E
residue 93
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence A
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801


Display surface

Download
Links