eF-site ID 6iqw-A
PDB Code 6iqw
Chain A

click to enlarge
Title Cryo-EM structure of Csm effector complex
Classification RNA BINDING PROTEIN/RNA
Compound Csm1
Source (6IQW)
Sequence A:  MEIDELTALGGLLHDIGKPVQRAGLYSGDHSTQGARFLRD
LAENTGRAEYELLSLFSEFHHKGHMKNDELMIRRIKELSP
ERFGLTMEDVLNALWIVYEADNLASGPQASRPLYSVFNPG
KAYPWAELDFEKELPVPGDVFSIRSQDYRELVKRLWEELS
KAKLRSDRLLPVLEKYLTFVSSVTSEGNIISLYDHMRMTS
AIALAMLRAGCTAEDVRSGRCRKEKRFLLIEGDFSGIQDF
IYRVSGKGTLKYLRARSAYLELIGWDVVLEILSRLGLTRA
NVVFNAGGHFMIIAQNTPDAVKELEEIRAKAVEWLYREFE
SDLYLAIEWEPVSGREFGREGGKNLFAEARKRLKHKLTVR
KLKRFGEIKGLFEHGHTERLAECPVCGRELPEGKLEPSAS
DPETKVCPTCNRLVSLGGNLPKLLGFGRTAKNDAGVLVEG
PFSGFVPYLQGGRPVGEQILVKNTLNPGEIPESAQFVPYF
VADYFKKDPKGGVATFEELSMASTGTRRLGVMKGDVDRLG
EFFSSMDSPSKLATASRFMDYFFKGYIGAIIEGKFGYIIG
DVPSLRDWPEEPDIVVVYAGGDDFFIVGAWDQIFELAFRV
RRAFNAYTGGKLTLSVGLGYFDERTPIYRMADVVSERLDT
AKDEGRNRVFVVGRSRPLDGKHKLSYEWNHYEELWRTYAP
RIYAGNGRLKGKLESKKGLLWKLLEIRELYVRDPNDVRWA
YLTAYLLGRHGLSDLFPELVGIDTKAVERKEPQPVYWVDG
VLKIVLMAVRR
Description (1)  Csm1, Csm2, Csm3, Csm4, Csm5/RNA Complex


Functional site

1) chain A
residue 290
type
ligand
sequence F
description binding site for residue ATP A 801
source : AC1

2) chain A
residue 295
type
ligand
sequence H
description binding site for residue ATP A 801
source : AC1

3) chain A
residue 521
type
ligand
sequence D
description binding site for residue ATP A 801
source : AC1

4) chain A
residue 522
type
ligand
sequence V
description binding site for residue ATP A 801
source : AC1

5) chain A
residue 524
type
ligand
sequence R
description binding site for residue ATP A 801
source : AC1

6) chain A
residue 525
type
ligand
sequence L
description binding site for residue ATP A 801
source : AC1

7) chain A
residue 526
type
ligand
sequence G
description binding site for residue ATP A 801
source : AC1

8) chain A
residue 529
type
ligand
sequence F
description binding site for residue ATP A 801
source : AC1

9) chain A
residue 542
type
ligand
sequence S
description binding site for residue ATP A 801
source : AC1

10) chain A
residue 587
type
ligand
sequence G
description binding site for residue ATP A 801
source : AC1

11) chain A
residue 588
type
ligand
sequence D
description binding site for residue ATP A 801
source : AC1

12) chain A
residue 648
type
ligand
sequence K
description binding site for residue ATP A 801
source : AC1

13) chain A
residue 652
type
ligand
sequence R
description binding site for residue ATP A 801
source : AC1

14) chain A
residue 239
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence D
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

15) chain A
residue 290
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence F
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

16) chain A
residue 292
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence A
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

17) chain A
residue 295
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence H
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

18) chain A
residue 360
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence K
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

19) chain A
residue 521-527
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence DVDRLGE
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

20) chain A
residue 529
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence F
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

21) chain A
residue 542
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence S
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

22) chain A
residue 545-546
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence MD
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

23) chain A
residue 587-588
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence GD
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

24) chain A
residue 648
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence K
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801

25) chain A
residue 652
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence R
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6iqw_A_801


Display surface

Download
Links