eF-site ID 6io1-B PDB Code 6io1 Chain B click to enlarge Title Crystal structure of a novel thermostable (S)-enantioselective omega-transaminase from Thermomicrobium roseum Classification TRANSFERASE Compound Aminotransferase, class III Source (B9L0K9_THERP) Sequence B:  ETWNAAELVAKDIAHHLHPLTNLYQLRREGPLVLVRGEGV WVWDAEGKRYLDGFAGLWNVNIGHGRRELAEAAREQMERV AFVPTFFGLASPPTIELAARLAELFPGPLDHFQFTSGGAE SNETAIKIARYYWWLKGQPERVKILSRRMAYHGIAMGALS ATGVPAYWEGFGPRPPGFIHLTAPYKYRFGEGLTDEEFVA RLVQELEETIEREGSETIAAFIGEPVQGAGGVVVPPDGYW PAIAAVLRKYGILLILDEVITGFGRTGTLFGMQQYGVQPD IVTFAKGITSGYVPLGGVGVSDEIAETLASADRVFMHGFT YSGHPVACAVALRNLDILLAERLWENAAASGAYLLQELKR LEERPYVGEVRGKGLMLLVEVVRDKASKEKFPPEFKLGPK LEAATRRRGIIVRCTPDGIVMAPPLTISRAECDVLIEGVA AALSDVLD Description Functional site 1) chain B residue 120 type sequence G description binding site for residue PMP B 701 source : AC1 2) chain B residue 121 type sequence G description binding site for residue PMP B 701 source : AC1 3) chain B residue 122 type sequence A description binding site for residue PMP B 701 source : AC1 4) chain B residue 125 type sequence N description binding site for residue PMP B 701 source : AC1 5) chain B residue 154 type sequence Y description binding site for residue PMP B 701 source : AC1 6) chain B residue 155 type sequence H description binding site for residue PMP B 701 source : AC1 7) chain B residue 156 type sequence G description binding site for residue PMP B 701 source : AC1 8) chain B residue 227 type sequence E description binding site for residue PMP B 701 source : AC1 9) chain B residue 260 type sequence D description binding site for residue PMP B 701 source : AC1 10) chain B residue 262 type sequence V description binding site for residue PMP B 701 source : AC1 11) chain B residue 263 type sequence I description binding site for residue PMP B 701 source : AC1 12) chain B residue 289 type sequence K description binding site for residue PMP B 701 source : AC1

Display surface Download Links