eF-site ID 6int-F
PDB Code 6int
Chain F

click to enlarge
Title xylose isomerase from Paenibacillus sp. R4
Classification ISOMERASE
Compound Xylose isomerase
Source (6INT)
Sequence F:  YFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLR
FGVAYLSGMELAKARVEACFELLNILDVDYFCFHDRDIAP
EGDTLQETNRNLDEIVALIKQHMHSSGKKLLWNTANMFTN
PRFVHGAATTSNADVFAYAAAQVKKALDHGKELGAENYVF
WGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDA
QFLIEPKPKEPSKHQYDFDAATTLQFLQKYDLAKHFKLNL
EANHATLAGHTFEHELRVARINGALGSIDANQGDLLLGWD
TDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTS
FEPIDVVYAHINGMDAFARGLQVAAKLIEDRAFDNVIEER
YASFTKGIGADIVSGKANFHTLEAYALQNNPITNKSGRVE
LLRSILNQYIINV
Description (1)  Xylose isomerase


Functional site

1) chain F
residue 230
type
ligand
sequence E
description binding site for residue CA F 501
source : AD7

2) chain F
residue 266
type
ligand
sequence E
description binding site for residue CA F 501
source : AD7

3) chain F
residue 294
type
ligand
sequence D
description binding site for residue CA F 501
source : AD7

4) chain F
residue 338
type
ligand
sequence D
description binding site for residue CA F 501
source : AD7

5) chain F
residue 266
type
ligand
sequence E
description binding site for residue CA F 502
source : AD8

6) chain F
residue 269
type
ligand
sequence H
description binding site for residue CA F 502
source : AD8

7) chain F
residue 305
type
ligand
sequence D
description binding site for residue CA F 502
source : AD8

8) chain F
residue 307
type
ligand
sequence D
description binding site for residue CA F 502
source : AD8

9) chain F
residue 191
type
ligand
sequence G
description binding site for residue CA F 503
source : AD9

10) chain F
residue 203
type
ligand
sequence E
description binding site for residue CA F 503
source : AD9


Display surface

Download
Links