eF-site ID 6int-E
PDB Code 6int
Chain E

click to enlarge
Title xylose isomerase from Paenibacillus sp. R4
Classification ISOMERASE
Compound Xylose isomerase
Source (6INT)
Sequence E:  FDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRF
GVAYLSGMELAKARVEACFELLNILDVDYFCFHDRDIAPE
GDTLQETNRNLDEIVALIKQHMHSSGKKLLWNTANMFTNP
RFVHGAATTSNADVFAYAAAQVKKALDHGKELGAENYVFW
GGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQ
FLIEPKPKEPSKHQYDFDAATTLQFLQKYDLAKHFKLNLE
ANHATLAGHTFEHELRVARINGALGSIDANQGDLLLGWDT
DEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSF
EPIDVVYAHINGMDAFARGLQVAAKLIEDRAFDNVIEERY
ASFTKGIGADIVSGKANFHTLEAYALQNNPITNKSGRVEL
LRSILNQYIINV
Description (1)  Xylose isomerase


Functional site

1) chain E
residue 230
type
ligand
sequence E
description binding site for residue CA E 501
source : AD4

2) chain E
residue 266
type
ligand
sequence E
description binding site for residue CA E 501
source : AD4

3) chain E
residue 294
type
ligand
sequence D
description binding site for residue CA E 501
source : AD4

4) chain E
residue 338
type
ligand
sequence D
description binding site for residue CA E 501
source : AD4

5) chain E
residue 266
type
ligand
sequence E
description binding site for residue CA E 502
source : AD5

6) chain E
residue 269
type
ligand
sequence H
description binding site for residue CA E 502
source : AD5

7) chain E
residue 305
type
ligand
sequence D
description binding site for residue CA E 502
source : AD5

8) chain E
residue 307
type
ligand
sequence D
description binding site for residue CA E 502
source : AD5

9) chain E
residue 191
type
ligand
sequence G
description binding site for residue CA E 503
source : AD6

10) chain E
residue 203
type
ligand
sequence E
description binding site for residue CA E 503
source : AD6


Display surface

Download
Links